PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10001964m
Common NameEUTSA_v10001964mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family CPP
Protein Properties Length: 518aa    MW: 55906.5 Da    PI: 7.3369
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10001964mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.29.3e-1592131141
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                      ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e
  Thhalv10001964m  92 QKKKHCNCKHSRCLKLYCECFASGAYCDG-CNCINCFNNVE 131
                      589**************************.********976 PP

2TCR50.93e-16175214140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      k++kgC+Ckks ClkkYCeCf+a+  Cs++CkC +CkN e
  Thhalv10001964m 175 KHHKGCHCKKSGCLKKYCECFQANILCSDNCKCLGCKNFE 214
                      589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-1792132IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.34893215IPR005172CRC domain
PfamPF036385.0E-1194129IPR005172CRC domain
SMARTSM011146.6E-20175216IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.2E-13178213IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MGEGVEFPPK KEVPDSEESD IPTKKSARQL DFTGGSGSDV EPSQSNKTSA ASISSTATVV  60
TPIPLSESHA QIRLPKTESP KSKPRPVDGT PQKKKHCNCK HSRCLKLYCE CFASGAYCDG  120
CNCINCFNNV ESEPARREAV ESTLERNPNA FRPKIASSDA RDNREEVGGV VMLGKHHKGC  180
HCKKSGCLKK YCECFQANIL CSDNCKCLGC KNFEGSEDRL ALFHGEHSHN VAYLQHANAA  240
ITGAIGSSGF ASSPAPKRKK DQDFFFTQPT KDSSNHRLGQ ANSVRMTSSK PVSRRGGNAS  300
LGPSKVLYRS LLADIIQPQD VKALCSVLVS VAGEVAEKRL EDKTETSLAS SAKDNNKGTE  360
AEREASGNQA DKSGAEESNS DGSKSRDLSP ETLALMCDEQ DTMLMVAASP KCLVESSSQL  420
PNGQDQVYSE QEKVVLTKFR DCLNRIISYG EFKESNCSLS RMDLDSPVQT AVKIEPVVQE  480
GAVANGVSQT TKQQPSQLTS SHAQIQQPQA LSEKKDQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-299422411132Protein lin-54 homolog
5fd3_B2e-299422411132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10001964m
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006408925.10.0protein tesmin/TSO1-like CXC 6
SwissprotQ9SL700.0TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLV4MD000.0V4MD00_EUTSA; Uncharacterized protein
STRINGXP_006408925.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.10.0Tesmin/TSO1-like CXC domain-containing protein