PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10001200m
Common NameEUTSA_v10001200mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 286aa    MW: 32797.8 Da    PI: 5.4527
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10001200mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1707.7e-5361341128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeel+++yLk+kveg ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF++rdkky++g r+nr tk+gyWkatgkd+++
  Thhalv10001200m   6 LPPGFRFHPTDEELIDYYLKRKVEGLEIEL-EVIPVIDLYKFDPWELPdKsFLPNRDMEWFFFCSRDKKYPNGFRTNRGTKAGYWKATGKDRKI 98 
                      79****************************.99**************96435556888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++++++g +ktLvfykgrap g +t+W+mheyrl
  Thhalv10001200m  99 TCRSSSTIGYRKTLVFYKGRAPLGDRTSWLMHEYRL 134
                      **********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-593159IPR003441NAC domain
PROSITE profilePS5100558.096159IPR003441NAC domain
PfamPF023652.0E-287134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGSSCLPPGF RFHPTDEELI DYYLKRKVEG LEIELEVIPV IDLYKFDPWE LPDKSFLPNR  60
DMEWFFFCSR DKKYPNGFRT NRGTKAGYWK ATGKDRKITC RSSSTIGYRK TLVFYKGRAP  120
LGDRTSWLMH EYRLCDDENP SQGSQHLKGA FVLCRVAKKN EIKTNSRIRK NLSEQTLGSG  180
ESSGYSSLVT SPSRDEAMPF HSFVNPVSTE SDSSNIWISP DFILDSSKDY PQIQDAASEY  240
FQDFDFPAIG NQNMDFPPST LSMNVDQSMY ESMQTSFCGY DQTGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-49616017166NO APICAL MERISTEM PROTEIN
1ut4_B2e-49616017166NO APICAL MERISTEM PROTEIN
1ut7_A2e-49616017166NO APICAL MERISTEM PROTEIN
1ut7_B2e-49616017166NO APICAL MERISTEM PROTEIN
3swm_A2e-49616020169NAC domain-containing protein 19
3swm_B2e-49616020169NAC domain-containing protein 19
3swm_C2e-49616020169NAC domain-containing protein 19
3swm_D2e-49616020169NAC domain-containing protein 19
3swp_A2e-49616020169NAC domain-containing protein 19
3swp_B2e-49616020169NAC domain-containing protein 19
3swp_C2e-49616020169NAC domain-containing protein 19
3swp_D2e-49616020169NAC domain-containing protein 19
4dul_A2e-49616017166NAC domain-containing protein 19
4dul_B2e-49616017166NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00546DAPTransfer from AT5G46590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0205550.0BT020555.1 Arabidopsis thaliana At5g46590 gene, complete cds.
GenBankBT0203050.0BT020305.1 Arabidopsis thaliana At5g46590 gene, complete cds.
GenBankAB4937780.0AB493778.1 Arabidopsis thaliana At5g46590 mRNA for hypothetical protein, partial cds, clone: RAAt5g46590.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006398354.10.0hypothetical protein EUTSA_v10001200mg, partial
SwissprotA4VCM01e-68NAC45_ARATH; NAC domain-containing protein 45
SwissprotQ9FFI58e-69NAC86_ARATH; NAC domain-containing protein 86
TrEMBLV4LBN60.0V4LBN6_EUTSA; Uncharacterized protein (Fragment)
STRINGfgenesh2_kg.8__135__AT5G46590.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21512777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46590.11e-171NAC domain containing protein 96