PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000520m
Common NameEUTSA_v10000520mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 318aa    MW: 35904.1 Da    PI: 9.1104
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000520mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.71.3e-54161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp k+k   kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++
  Thhalv10000520m  16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPDKAKMVGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFN 108
                      79*************************999.88***************88888999*************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++elvg+kktLvfy+grap+gekt+Wvmheyrl
  Thhalv10000520m 109 StTSELVGMKKTLVFYRGRAPRGEKTSWVMHEYRL 143
                      878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6213165IPR003441NAC domain
PROSITE profilePS5100561.16916165IPR003441NAC domain
PfamPF023657.8E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEQGDQQQQK KKEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE  60
LPDKAKMVGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEIFNST TSELVGMKKT  120
LVFYRGRAPR GEKTSWVMHE YRLHSKSSYR TSKQDEWVVC RVFKKTEATK KYISNSSSST  180
SQHNQNHTRS SLLSTNNNNN PNYSSDLLQL PPHLQPHSSL NINHTLMANA VHLAELSRVF  240
RASTSSNMDS SQQLMSYTHM PVSGLNLNLG GGLVQPPPPT VSLEDVVAVS ASFNGENGFG  300
NVEMSQCMDL DGYWPSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-5741715171NAC domain-containing protein 19
4dul_A1e-5741715171NAC domain-containing protein 19
1ut7_B1e-5741715171NO APICAL MERISTEM PROTEIN
1ut7_A1e-5741715171NO APICAL MERISTEM PROTEIN
1ut4_B1e-5741715171NO APICAL MERISTEM PROTEIN
1ut4_A1e-5741715171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064031e-159AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence.
GenBankCP0026851e-159CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404976.10.0hypothetical protein EUTSA_v10000520mg
SwissprotQ9S8511e-78NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLV4LRH90.0V4LRH9_EUTSA; Uncharacterized protein
STRINGBra032095.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-167NAC domain containing protein 38