PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000520m
Common NameEUTSA_v10000520mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family NAC
Protein Properties Length: 318aa    MW: 35904.1 Da    PI: 9.1104
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000520mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.71.3e-54161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeel+++yL +k+++++++  ++i++vd++k+ePw+Lp k+k   kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke+++
  Thhalv10000520m  16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPDKAKMVGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFN 108
                      79*************************999.88***************88888999*************************************9 PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + ++elvg+kktLvfy+grap+gekt+Wvmheyrl
  Thhalv10000520m 109 StTSELVGMKKTLVFYRGRAPRGEKTSWVMHEYRL 143
                      878889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-6213165IPR003441NAC domain
PROSITE profilePS5100561.16916165IPR003441NAC domain
PfamPF023657.8E-2917143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEQGDQQQQK KKEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE  60
LPDKAKMVGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEIFNST TSELVGMKKT  120
LVFYRGRAPR GEKTSWVMHE YRLHSKSSYR TSKQDEWVVC RVFKKTEATK KYISNSSSST  180
SQHNQNHTRS SLLSTNNNNN PNYSSDLLQL PPHLQPHSSL NINHTLMANA VHLAELSRVF  240
RASTSSNMDS SQQLMSYTHM PVSGLNLNLG GGLVQPPPPT VSLEDVVAVS ASFNGENGFG  300
NVEMSQCMDL DGYWPSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-5741715171NO APICAL MERISTEM PROTEIN
1ut4_B2e-5741715171NO APICAL MERISTEM PROTEIN
1ut7_A2e-5741715171NO APICAL MERISTEM PROTEIN
1ut7_B2e-5741715171NO APICAL MERISTEM PROTEIN
4dul_A2e-5741715171NAC domain-containing protein 19
4dul_B2e-5741715171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapThhalv10000520m
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064031e-159AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence.
GenBankCP0026851e-159CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404976.10.0protein CUP-SHAPED COTYLEDON 3
RefseqXP_024014216.10.0protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8512e-77NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLV4LRH90.0V4LRH9_EUTSA; Uncharacterized protein
STRINGXP_006404976.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM68512841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-167NAC domain containing protein 38
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]