PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000176m
Common NameEUTSA_v10000176mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 417aa    MW: 45282.8 Da    PI: 9.5049
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000176mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.1e-10273321553
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                      k+ +r   NRe+A rs ++K +++ +Le+kv+ L+++  ++ +++ +l+
  Thhalv10000176m 273 KNVKRILANRESAARSKEKKAQYMNKLENKVEFLQTQAVTMSSKVAHLE 321
                      7889999*************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-12269333IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.415271334IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.5E-10273324No hitNo description
SuperFamilySSF579591.13E-9273323No hitNo description
PfamPF001702.0E-8273321IPR004827Basic-leucine zipper domain
CDDcd147031.98E-17275322No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MNPQDDITPL SSSSIHSTQI PAPSANGGAA GGSGKRAGVP PSPRSLIPPP SPYSQIPTTR  60
QPIASQNFTP GPMSQYSSPF FSYDSFPPPP PPYRDSPSAL PPIPFARGSG SGSSGLPPRK  120
AHRRANSDNI ISGLNAMLAQ NTPRLIYPKP IHMPVGVGVE SSKEGDELSN GDDDDLERSS  180
SDPDATDEQT VSKTTTTSGV KRRAGKEIAT STRLCRSVSM DTSLNDQTQP KLPPSPRNLQ  240
VTIPVRDDVF TEAEMIKIQA SRKLKLLAAS DPKNVKRILA NRESAARSKE KKAQYMNKLE  300
NKVEFLQTQA VTMSSKVAHL ERVNLVMENE NRELRIRLQG LEQQAQLRDS LIGQLTGEVH  360
RLKVATGEVV NQNFGETDGT NMQPVNANMQ PVNANMFEQL NLNNQLHQPQ TNPDFQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1285293ARSKEKKAQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404563.10.0hypothetical protein EUTSA_v10000176mg
TrEMBLV4NIG60.0V4NIG6_EUTSA; Uncharacterized protein
STRINGAl_scaffold_0007_766e-74(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-45bZIP family protein