PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000129m
Common NameEUTSA_v10000129mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family bZIP
Protein Properties Length: 520aa    MW: 56226.6 Da    PI: 9.1224
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000129mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.62.1e-11378436563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr +r   NR++A rs +RK  +++eLe kv++L++e ++L  +l +l+  +  l++++
  Thhalv10000129m 378 KRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQN 436
                      899*********************************************99888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-19374438IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749376439IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-12378432No hitNo description
PfamPF001701.2E-9378435IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11378434No hitNo description
CDDcd147031.52E-21379428No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MGDTDTNMMQ RANSSSGTSS SSIPKQQSVT VPINQHLSPA LIRSPHFRQP FGGGNNGAGN  60
RVGAPPPIPP ISPYSQIPAT LQPRHSRSMS QPSSFFSFDS LPPLKPTPPM EERTGAGFSP  120
SLPPSPFTMC HSSSRITGDG ENLPPRKSHR RSNSDVTFGF SSMMGQSQKS PPLIPARSLE  180
RSISGGGEVS DWSNLVKEEP REGFLRGRKP ETEAMDDVFT AYMNLDNIDV LNSFGGGEDG  240
KTSNENVEEM ESSRGSGTRK TNGGSCSDSE GESSACGNVK VAVAASSSGV KRRAGGDIAP  300
TSRHYRSVSM DSCFMGKLNF GDEKLPPSSS AKVSPTNSGE GNSSAYSVEF GNSEFSAAEM  360
KKIAADEKLA EIVMADPKRV KRILANRVSA ARSKERKTRY MAELEHKVQT LQTEATTLSA  420
QLTHLQRDSM GLTNQNSELK FRLQAMEQQA QLRDALSEKL TEEVQRLKLV IGEPSRSSGS  480
KTSLNPEMFQ QLSISQLQQQ QMQHSNQNST MRAKHTSNE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBMTransfer from AT2G21230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404562.10.0hypothetical protein EUTSA_v10000129mg
TrEMBLV4L6Q30.0V4L6Q3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__38__AT2G21230.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156251417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21230.10.0bZIP family protein