PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943974.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 383aa    MW: 41312.1 Da    PI: 8.2066
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943974.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.1e-3991151262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  XP_010943974.1  91 QQAALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 151
                     57889*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3189149IPR003851Zinc finger, Dof-type
PfamPF027011.2E-3393149IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52595149IPR003851Zinc finger, Dof-type
PROSITE patternPS01361097133IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MLCNGERLGN PLTHEWPQSM GESLLIPGNN NSNSNSNNNN NSNNNNNAPT ASSSSNSTSA  60
STNNNNKNNK MIHAAAPPPA TRVIDRPAQE QQAALKCPRC DSSNTKFCYY NNYSLSQPRH  120
FCKACKRYWT RGGTLRNVPV GGGCRKNKRV KKPASAVVSD PKPPPLMPPT NSIIPPISSL  180
PKPTPHLDPS LFYSLPAARS NPPPPSSSDV GLAFPGLHPR FDPPSVPNSI SLPCTAFDLQ  240
HPQLNSLGLG FPSGQRDDEF NLDHLSVTND YPLFGSTAAS LLVSSLKEPK KVEDYRALMH  300
REDLQAPPLA ANGNLDAIKE VKLEGESNAI NSNRIDWQIP YENSFDAIGS APLPGDSSLL  360
YWNAAIGAWP DSANYGSSIA PLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943974.10.0dof zinc finger protein DOF1.4
TrEMBLA0A3Q0IE020.0A0A3Q0IE02_PHODC; dof zinc finger protein DOF1.4-like
STRINGXP_008806466.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.19e-36TARGET OF MONOPTEROS 6