PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 197aa    MW: 22721.7 Da    PI: 7.6689
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943359.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.56e-1383142463
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      +r rr+++NRe+ArrsR RK++ + eL   v  L a N++L +el++    +++   e+
  XP_010943359.1  83 ERRKRRMISNRESARRSRMRKQKHLRELLSQVMHLRAANRQLLDELNRVMRDYDQILHEN 142
                     689**********************************************99999987776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-1580144IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-981134No hitNo description
PROSITE profilePS5021711.40482145IPR004827Basic-leucine zipper domain
PfamPF001703.4E-1182142IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.63E-1184135No hitNo description
CDDcd147029.04E-1785136No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MQPGEVASIR YVAPPNPPSF QAHYNMAQNN NPSFPYCSIL GPYAVHQLQT IPLIHEISLL  60
GSCLGNNSTS DEAEENQLRL AEERRKRRMI SNRESARRSR MRKQKHLREL LSQVMHLRAA  120
NRQLLDELNR VMRDYDQILH ENAQLRDEES ELRKKLQDLL VDDTNGALQG LEEPCNTAHI  180
RAEPRDQQIT ASLKLLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
183104RRKRRMISNRESARRSRMRKQK
296103RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943359.11e-143PREDICTED: basic leucine zipper 43
STRINGGSMUA_Achr6P36230_0011e-58(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-33basic leucine-zipper 42