PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943306.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 318aa    MW: 32769.1 Da    PI: 8.5886
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943306.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.34e-3940101263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     ++  +kcprCdstntkfCyynny+lsqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+sss
  XP_010943306.1  40 QQPPVKCPRCDSTNTKFCYYNNYNLSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKTKRSSS 101
                     56789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-233989IPR003851Zinc finger, Dof-type
PfamPF027016.5E-334398IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5164498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MQDFQSIPGV SGRIFGGGGG GGGGGADVRR LRGYPAAAQQ QPPVKCPRCD STNTKFCYYN  60
NYNLSQPRHF CKACRRYWTK GGVLRNVPVG GGCRKTKRSS SSSSSKTSKS SSTTGDGDKD  120
SRRPSASRSS SDSSSLTAAT TEASASASAS ASASVSASFP DSTLFASSQT SHPNLSFDPP  180
PQTVALDTLG HQAPEIFSQV AAGSSFTGLM ATAATSPAVL GFNFSDPPPI RVGPQQSPPK  240
AAATLAEEIR MPGLMDQTAP VDLPPFHGRS GGGGGGLTGL DWPATVDPSL FDLTSAVDPG  300
AFWNQGHWGD ADPSLYLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943306.10.0dof zinc finger protein 4
TrEMBLA0A2H3XUC41e-151A0A2H3XUC4_PHODC; dof zinc finger protein 4-like
STRINGXP_008788910.11e-152(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-28DOF zinc finger protein 1