PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010943073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 403aa    MW: 42897.4 Da    PI: 9.6
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010943073.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11e-14325377557
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                     +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+ ee+ ++ +
  XP_010943073.1 325 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKELNQELQKKQEEMMEMQK 377
                     79****************************************99999998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-12321386IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.887323374IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.04E-10325374No hitNo description
PfamPF001707.2E-13325378IPR004827Basic-leucine zipper domain
CDDcd147072.51E-28325379No hitNo description
Gene3DG3DSA:1.20.5.1706.7E-14325374No hitNo description
PROSITE patternPS000360328343IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MNFKNMGSSS DGRDGQPPPL ARQPSVYSLT FDEFQSTLGG HGKDFGSMNM DEFVKNIWTA  60
EESQVIAAAL GGAVGGGIDG GVAGTGLQRQ GSLTLPRTLS QKTVDEVWRD FIREGGQGSS  120
ISTGLHQQRQ PTLGEMTLEE FLVRAGVVRE DMTQPGVPRP IGNSSNNSNT NSNVFYGELP  180
NSNNNTGPAL GFPQTSLSNG TVVTNAFPNS SGANLAMPGT GTRPYAAPLP LGNTADLGTP  240
QGLIGDGVMG IGDQGMNNGM MPGVVGVGGA GVTVAAMGSP VNQMPTDGLS KGNGNLSSLS  300
PVPYMFTGGL RGRKCSGAVE KVVERRQRRM IKNRESAARS RARKQAYTME LEAEVAKLKE  360
LNQELQKKQE EMMEMQKNKV LEIINQQHVP KKRCLRRTLT GPW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010943073.10.0PREDICTED: bZIP transcription factor TRAB1 isoform X1
RefseqXP_010943074.10.0PREDICTED: bZIP transcription factor TRAB1 isoform X1
SwissprotQ9M7Q41e-101AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLG8FGG50.0G8FGG5_ELAGV; Putative abscissic acid
STRINGGSMUA_Achr6P30550_0011e-165(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-61abscisic acid responsive elements-binding factor 2