PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010942456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family HRT-like
Protein Properties Length: 524aa    MW: 58288.6 Da    PI: 10.0276
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010942456.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like48.61.4e-15272302131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv+++ G vC+++PvkgR RCeeHKG+Ri
  XP_010942456.1 272 ICGVAIGGGLVCRNKPVKGRERCEEHKGRRI 302
                     8*****************************7 PP

2HRT-like44.42.9e-14322352131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CG+  e GsvC++ +++gRKRCe HKG+R+
  XP_010942456.1 322 VCGFFSEGGSVCSELAIHGRKRCELHKGRRV 352
                     7*****************************7 PP

3HRT-like54.32.2e-17387417131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv   dGs+C+++Pv gRKRCe HKG+Ri
  XP_010942456.1 387 ICGVVYWDGSICRKKPVSGRKRCEHHKGQRI 417
                     8*****************************7 PP

4HRT-like52.96.3e-17442472131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     iCGv ++dG vC+r+Pv gRKRCeeHKG+R+
  XP_010942456.1 442 ICGVVIGDGYVCRRKPVIGRKRCEEHKGRRV 472
                     8*****************************7 PP

5HRT-like581.6e-18494523231
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     CGv+l++Gs+C+++Pv+gRKRC  HKG+R+
  XP_010942456.1 494 CGVTLSNGSICMNSPVPGRKRCSLHKGRRV 523
                     *****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MSPRLKREEC LRTKHDSLFS KWKVLIGPSD WEDYSLGKDG VERYRIHNIP IHSACPGLYE  60
LGIASNPGGE DKRTRRHAAE NVIVVYLGQA DNVRTRLQQY GRAGAHLDQR NSSTSADKIE  120
FPFTQNGPGL FKEIFSRGHS IMFRWVPMTS KKEAEKKEAS LLEVFDYAWN RRGNGVCRRE  180
EVLSKLDNAA RPLSKLDNAA TSPISSAYRK VQQWKQTVFD KKAGIKINGS MPLDEVGSSE  240
GRKGFLPDVL KFVTSRPRLV QGGDGIPGDH DICGVAIGGG LVCRNKPVKG RERCEEHKGR  300
RIAGIGKVTS GEVTATSEKS SVCGFFSEGG SVCSELAIHG RKRCELHKGR RVLESHLHIS  360
SDSKLQSHMM LTKNITSAYD VDQEYNICGV VYWDGSICRK KPVSGRKRCE HHKGQRIAGT  420
RLLTSEDWMT KKECNLDEPY DICGVVIGDG YVCRRKPVIG RKRCEEHKGR RVTSPGLMIS  480
MESSRAVSRS SSACGVTLSN GSICMNSPVP GRKRCSLHKG RRVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942456.10.0PREDICTED: uncharacterized protein LOC105060444
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-82effector of transcription2