PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010942362.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family LFY
Protein Properties Length: 451aa    MW: 50609.8 Da    PI: 7.3136
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010942362.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY5991e-18214251386
         FLO_LFY   1 mdp.eafsaslfkwdpraaa...aapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmk 91 
                     mdp +afsa++fkwdp a     +  p+ ++ e+  +++++++    ++++ rel e+f +yGvry+tva+++elGft+stLv+m++ e++++++
  XP_010942362.1   1 MDPgDAFSANIFKWDPPAPPpcrSMEPTPAAAEEGEEPQQMQERRGGEECQPRELGEVFAGYGVRYATVARLGELGFTASTLVGMTEGEVEEVLS 95 
                     666367*********64332232222233333333344445666666777789****************************************** PP

         FLO_LFY  92 slseifrldllvGeryGikaavraerrrlee....................eeaekkrrkll..........sedeetaldalsqeglseepvqe 156
                     +l+++fr+dll+GeryGikaa+r errrl +                    ++ +++rr ll              ++aldalsqeglseepvq+
  XP_010942362.1  96 ALAHLFRWDLLLGERYGIKAALRVERRRLLDhhqamlflrhdhnhqpaagvDD-DARRRMLLlnspghlhhnLGGLNHALDALSQEGLSEEPVQQ 189
                     *****************************999******************644.5555554447776543222223459**************** PP

         FLO_LFY 157 ekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg..sgedge.....erqrehPfivtepgevarg 244
                     e+eaa+sgge  ++ + +++++++++++ kk++++k+k+kk++++  ee+e+eeeee+ed+ g  ++e+g+     erqrehPfivtepgevar+
  XP_010942362.1 190 EREAAASGGEAINDDGRAKQRRSTKKSKAKKKNRRKNKKKKQRSS-PEEEEEEEEEEEEDGWGtgGSEEGSersvvERQREHPFIVTEPGEVARA 283
                     *********998877777666544444444443333333333332.2233333333333332222333343566779****************** PP

         FLO_LFY 245 kknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqa 339
                     kknGLDYLf+LyeqCr+fLlqvq++akerG+kcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrra+kergenvGawrqa
  XP_010942362.1 284 KKNGLDYLFHLYEQCRHFLLQVQSLAKERGDKCPTKVTNQVFRYAKKVGASYINKPKMRHYVHCYALHCLDEEASNALRRAYKERGENVGAWRQA 378
                     *********************************************************************************************** PP

         FLO_LFY 340 cykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                     cykplvai+ar+gwdidavfnahprLsiWYvPtkLrqLChl+rs+a+
  XP_010942362.1 379 CYKPLVAISARHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLARSNAA 425
                     ********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.6E-1871425IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MDPGDAFSAN IFKWDPPAPP PCRSMEPTPA AAEEGEEPQQ MQERRGGEEC QPRELGEVFA  60
GYGVRYATVA RLGELGFTAS TLVGMTEGEV EEVLSALAHL FRWDLLLGER YGIKAALRVE  120
RRRLLDHHQA MLFLRHDHNH QPAAGVDDDA RRRMLLLNSP GHLHHNLGGL NHALDALSQE  180
GLSEEPVQQE REAAASGGEA INDDGRAKQR RSTKKSKAKK KNRRKNKKKK QRSSPEEEEE  240
EEEEEEEDGW GTGGSEEGSE RSVVERQREH PFIVTEPGEV ARAKKNGLDY LFHLYEQCRH  300
FLLQVQSLAK ERGDKCPTKV TNQVFRYAKK VGASYINKPK MRHYVHCYAL HCLDEEASNA  360
LRRAYKERGE NVGAWRQACY KPLVAISARH GWDIDAVFNA HPRLSIWYVP TKLRQLCHLA  420
RSNAATAASS SVLGATSSDG LPPPPPPPPM F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1082644413192PROTEIN LEAFY
2vy2_A1e-1082644413192PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209215RRSTKKS
2219227KKNRRKNKK
3220225KNRRKN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor that act to specify determinacy in the progenitor cells for both flowers and leaves.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942362.10.0floricaula protein
SwissprotO040641e-152FLLH_POPTR; Floricaula/leafy homolog
SwissprotQ405051e-152FL2_TOBAC; Floricaula/leafy homolog 2
TrEMBLA0A2H3WXH30.0A0A2H3WXH3_PHODC; floricaula/leafy homolog
STRINGXP_008775161.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-101floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]