PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010942236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 155aa    MW: 17816 Da    PI: 8.7177
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010942236.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.81.3e-1464122563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     +r rr+++NRe+ArrsR RK+  ++eL+  v  L a N++L++e+++  +e ++  +e+
  XP_010942236.1  64 RRKRRMISNRESARRSRMRKQRHLDELRSQVVYLRATNRRLIDEINQVMEERDRILQEN 122
                     699*************************************************9999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.9E-1560124IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.10562118IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.1E-1264117No hitNo description
PfamPF001703.1E-1264122IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.39E-1264114No hitNo description
CDDcd147021.54E-1565116No hitNo description
PROSITE patternPS0003606782IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MYPHEVAGLQ YGGQLDLLRF FGVYASQVQA MCSVDGVCLP SSGPGNNSTS DEADKHQASL  60
VHERRKRRMI SNRESARRSR MRKQRHLDEL RSQVVYLRAT NRRLIDEINQ VMEERDRILQ  120
ENSWLREEAS DLQKKLDDMQ VKSTTSAAPR APDEA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17683RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942236.11e-112PREDICTED: basic leucine zipper 43-like
TrEMBLA0A067JK131e-41A0A067JK13_JATCU; Uncharacterized protein
STRINGGLYMA02G13960.23e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.16e-37basic leucine-zipper 42