PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941869.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 231aa    MW: 24188.2 Da    PI: 7.7537
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941869.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.59e-362680559
          zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                      +cprCds++tkfCyynny++sqPr+fC++CrryWt GG+lrnvP+Gg++rk+ 
  XP_010941869.1 26 RERCPRCDSRDTKFCYYNNYNTSQPRHFCRSCRRYWTLGGSLRNVPIGGSSRKRL 80
                    568*************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.8942781IPR003851Zinc finger, Dof-type
PfamPF027016.9E-312779IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-183474IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MPSEMGDGRR RQAERPAEEA AAERGRERCP RCDSRDTKFC YYNNYNTSQP RHFCRSCRRY  60
WTLGGSLRNV PIGGSSRKRL RPSPAATSAA ARPLRPIPTL APPTPSLDLP ASTSPPSAFG  120
SLLSSPVSAG FLALGEPFFE VRTGFELGLG LGLGSGPAAS PSIEELGFGL GTTLLWPTAL  180
LDEEGVVGAG DTWRLGSAGM DCFAAPAPAA VWPDLAIAPA EGSGGAGGEL R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941869.11e-162dof zinc finger protein DOF1.7
TrEMBLA0A3Q0I6M51e-107A0A3Q0I6M5_PHODC; dof zinc finger protein MNB1A-like
STRINGXP_008813223.14e-99(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.12e-23DOF zinc finger protein 2