PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941851.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 347aa    MW: 36916.4 Da    PI: 8.4747
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941851.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.53.4e-3953111260
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                     ++++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk k+
  XP_010941851.1  53 PQQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKAKA 111
                     78999***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-2553107IPR003851Zinc finger, Dof-type
PfamPF027017.5E-3355111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.23657111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MIQELLGGAL EERKISIPGS LLIDPSSSSS SSTSISSTSL SSNSSSPSTT SEPQQNLRCP  60
RCDSSNTKFC YYNNYNLTQP RHFCKTCRRY WTKGGALRNV PIGGGCRKAK AAPAIAAGGT  120
KFGATKAKPA STDLLARSGI GGGLEHELPS GPILWASPHT SHLMALLRAT SVQNPNPNTH  180
SSPTLNSVRI KEDGAMIGTC LAADKVSILQ SQGLSLDPLG QLPISSNGAL WRNSNQYAYQ  240
QQPQPQQMQQ HSSMFLGEMP SSGIQELYQR IKSSANYCND QLQAVMSNVG CLDSTSSSAT  300
TTMTTTMGTS TATSILEPIP LSAGGEFNYW NPALNWSDLP TTNGSFP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941851.10.0dof zinc finger protein 2
TrEMBLA0A2H3Y2U91e-171A0A2H3Y2U9_PHODC; dof zinc finger protein DOF2.2-like
STRINGXP_008792599.11e-172(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.21e-31Dof family protein