PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 555aa    MW: 60141.7 Da    PI: 7.1659
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940929.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31.1e-10401459563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l  l+  +  l+s++
  XP_010940929.1 401 KRVKRILANRQSAARSKERKMRYIAELEHKVQTLQTEATTLSAQLTLLQRDSTGLTSQN 459
                     899*********************************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-19397461IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.795399462IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-11401458No hitNo description
SuperFamilySSF579593.09E-11401456No hitNo description
PfamPF001701.6E-9401459IPR004827Basic-leucine zipper domain
CDDcd147031.92E-23402453No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MEEAESSRNE WMQRLKLSTG TCSSTLPNLP NIFDLSSFNS SSQARGPHCP LPPSPSFSPE  60
ASKRPGIPPA HPTLPPALPP TPQIPSAAAA AAAPSHSRSL SQPAFFNLDS FASLSPPSSS  120
ADAPMEDRVT ASSPTPAEAP LARSSSGRAS GDGLPPRKAH RRSQSDVPFG FFQSSLPIAG  180
IPPLAPQRAQ GFLERSSSAR EGFGPGRQPP QFVKQENEWE RVGNSRAAGI GGRKPEGDSG  240
DDPVNAYMNL DSLDAMNSLG TEEKREDLDS RASGTKADSS ENESESSVNE SGSSVQFRTP  300
STEKKEGTKR SSPADLSPIN SRHCRSISMD GFMGELHFGD ESPKLPPSLG NQMGQHSRSG  360
SMDGTSSTFS LEFGNGEFSG ADMKKIMVNE KLAEMALTDP KRVKRILANR QSAARSKERK  420
MRYIAELEHK VQTLQTEATT LSAQLTLLQR DSTGLTSQNS ELKFRLQAME QQAQLRDALN  480
EALTAEVQRL KLAAGEITEA HLSKSLNQQM SLNPQLFHLQ QRQSQQQRHQ QSTQIPLFQL  540
QPQQQQHTDA AAKLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940929.10.0PREDICTED: transcription factor VIP1-like
TrEMBLF6I1810.0F6I181_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-90bZIP family protein