PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940885.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRAS
Protein Properties Length: 652aa    MW: 72713.5 Da    PI: 6.0312
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940885.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS419.92.2e-1282696371373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkfs 94 
                     lv+lL++cAe +ssg++e++  +Larl elasp+g+p++R++ayfteALa   ++ +++++++ pp+   +++   + ++al+l+++vsPi+kf 
  XP_010940885.1 269 LVSLLTSCAESISSGNHEAIAFYLARLGELASPRGSPIHRVVAYFTEALALCAVKLWPHIFSITPPRVLVDQSgDNDDATALQLLNQVSPIPKFL 363
                     689*************************************************************999988877788999**************** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+t N+ +l+a+eg++rvHiiDfdi+qGlQWp+L+q+La+R+++p ++RiTg+g+    s++ l+ tg rLa+fAe++++pfef++ v++rled+
  XP_010940885.1 364 HFTLNERLLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLACRANPPSHVRITGIGE----SRQDLHDTGARLARFAEAFNLPFEFHA-VVDRLEDV 453
                     *******************************************************....9**************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +l++L+vk+++++aVn+vl++h++l ++   +    ++L l++s++P +v ++eqea+hn++++ +r++++l+yysa+fdsl+ +lp++s +rik
  XP_010940885.1 454 RLWMLHVKREDCVAVNCVLMMHKTLYDENGGA--LMDLLGLIRSTNPAIVLMAEQEAQHNEPRWETRLANSLQYYSAIFDSLDCSLPEDSLARIK 546
                     ***********************996655444..479********************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve...eesgslvlgWkdrpLvsvSaW 373
                     +E++ ++rei+n+vaceg+er+ rhe++e+Wr+ +e+ GF+ + ++e+++ q +l+lr+++++ y+++   ees+ l+l W +++L++vSaW
  XP_010940885.1 547 IEEM-FAREIRNLVACEGSERVDRHEKFERWRKLMEDGGFRCMGIGEREMLQSRLILRMYNGENYSIDkqgEESDGLTLKWLNQSLYTVSAW 637
                     ****.********************************************************999****777779****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.26243615IPR005202Transcription factor GRAS
PfamPF035147.6E-126269637IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MLAGCSSALL SPRHQLRSDA SVQLQGSHFQ LQEKHHTSQQ RMGTQRFDLP CSFSRKDATR  60
VAISLEKPAE TRSSSCTFRP NPVTASSSSV VARAVSWEGR IEITEGGPWE RRRSSKRSHE  120
RSSSEEEDSC LDRAKRTRTG DTTGLVVGED DIWLPQCTKK HPLVEEEEEE EKVLLVPNAA  180
LFPFFTSASS TLVGSFETGR GSGTGVQPNN KSQSDSSSSS DTRSSSPKQH RDSSDNVARN  240
GPQIPYPSGF ASMVGQGENT QTEQQGLELV SLLTSCAESI SSGNHEAIAF YLARLGELAS  300
PRGSPIHRVV AYFTEALALC AVKLWPHIFS ITPPRVLVDQ SGDNDDATAL QLLNQVSPIP  360
KFLHFTLNER LLRAFEGKDR VHIIDFDIKQ GLQWPSLFQS LACRANPPSH VRITGIGESR  420
QDLHDTGARL ARFAEAFNLP FEFHAVVDRL EDVRLWMLHV KREDCVAVNC VLMMHKTLYD  480
ENGGALMDLL GLIRSTNPAI VLMAEQEAQH NEPRWETRLA NSLQYYSAIF DSLDCSLPED  540
SLARIKIEEM FAREIRNLVA CEGSERVDRH EKFERWRKLM EDGGFRCMGI GEREMLQSRL  600
ILRMYNGENY SIDKQGEESD GLTLKWLNQS LYTVSAWAPN DVAGSSATSQ PS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-422736378374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117RRSSKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940885.10.0PREDICTED: scarecrow-like protein 28
TrEMBLM0TF250.0M0TF25_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05850_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-160GRAS family protein