PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940398.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 298aa    MW: 33102.3 Da    PI: 8.2668
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940398.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.81.5e-3595152259
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                     k+k  +cprC+stntkfCyynnys sqPr+fC+aCrr+Wt GG+lrnvPvGggrr+++
  XP_010940398.1  95 KQKPARCPRCESTNTKFCYYNNYSKSQPRHFCRACRRHWTDGGTLRNVPVGGGRRNKR 152
                     68899*************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2293152IPR003851Zinc finger, Dof-type
PfamPF027015.1E-3197152IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.18699153IPR003851Zinc finger, Dof-type
PROSITE patternPS013610101137IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MLHSNPTCPL LLNAHSFLMS PHSTVQPHYK NLWQLSRRLV LLLPKHQRDS LQNLVVTMGF  60
SSKLVASDSL DRSQDGGLEI LKPKSEGKTQ DQQQKQKPAR CPRCESTNTK FCYYNNYSKS  120
QPRHFCRACR RHWTDGGTLR NVPVGGGRRN KRLNTEHNTS TSVDNNGVTI PQYQQQLQQM  180
PLPPFDGDNH SSSLPGILHQ VMLRPPPPPP LPLAYAMDGS GLCPVPPFQP EFGTAEADFS  240
TSSDNVINTL SSISSSSCSS PYNCTRLDPI PLPASYLSCW EDISDLVSAQ DSILSTYP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940398.10.0dof zinc finger protein DOF1.4
TrEMBLA0A2H3X8U03e-97A0A2H3X8U0_PHODC; dof zinc finger protein DOF3.4-like
STRINGXP_008780125.15e-98(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-27Dof family protein