PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940201.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family G2-like
Protein Properties Length: 292aa    MW: 32225.5 Da    PI: 8.8511
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940201.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.41.8e-29239290253
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ +
  XP_010940201.1 239 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQVF 290
                     9*************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.42E-14236291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-25237290IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-23239291IPR006447Myb domain, plants
PfamPF002496.3E-6240288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MPIQGIFMET TSMPSLDLSL HISPPSPTPS STPATDRDPS LGLLHRIEAL KPQAEDRSNL  60
LACTHLSLSS SSASLEADGS WRWQGPQHDR CQNSHLESVL DGSRPIKGIP IYSSSNPPFL  120
SADPEMGFNH QTLSSPSSWS SFFSSTPSPP PSSCGYSTHL DTMSSFLRSA GLVPSMGSSY  180
HRMMAPPTRF TGLSSDTIKY NQHYSHHQQH GIGPLDISQN MMRSRFMQKL PAKRSVRAPR  240
MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQVF FV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-14240290454Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940201.10.0transcription repressor KAN1
SwissprotQ0J2353e-35ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2H3ZP571e-166A0A2H3ZP57_PHODC; probable transcription factor RL9
STRINGXP_008798291.11e-116(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-36G2-like family protein