PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940118.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 151aa    MW: 17082.2 Da    PI: 9.0916
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940118.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.38.2e-143088563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++++r+ +NRe+ArrsR RK++ ++ L   v  L +eN++    l++ ++ +  +++++
  XP_010940118.1 30 RKQKRMLSNRESARRSRMRKQKHLDDLMAQVGHLMKENSQILAALNTTTQRYLGMEADN 88
                    79***************************************999999999887777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-102176No hitNo description
SMARTSM003385.9E-172690IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.7492891IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.56E-123081No hitNo description
PfamPF001707.0E-113081IPR004827Basic-leucine zipper domain
CDDcd147027.31E-193181No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MASSSGTSSG SSQLPNSGSE EDLQALMHQR KQKRMLSNRE SARRSRMRKQ KHLDDLMAQV  60
GHLMKENSQI LAALNTTTQR YLGMEADNSV LRTQMTELST RLQSLNEVLY YMNCGGNHGF  120
GPNDDSFTRP WSLMAENSQP IMASVDMFQY R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940118.11e-109PREDICTED: ocs element-binding factor 1-like
TrEMBLB9H0U01e-56B9H0U0_POPTR; Uncharacterized protein
STRINGPOPTR_0004s16560.13e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44593367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.14e-39G-box binding factor 6