PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010940065.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 300aa    MW: 32689.9 Da    PI: 7.2467
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010940065.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.54e-4052111261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +e+alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+s
  XP_010940065.1  52 HEQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRS 111
                     7899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2950110IPR003851Zinc finger, Dof-type
PfamPF027012.2E-3354110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.35756110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MVAPPMRICM DSPDWLKGIV HEDSGMGSSS PSGELISCSR PPVMERRLRP QHEQALKCPR  60
CDSTHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGSLRNVP VGGGCRKNKR SVAKKPSSEQ  120
PPHPVPSFQG GTDLHLSFSG VQFPHLDSLT DTPRNLNFME CKYNPMLGLS SPGELDLMDT  180
KFGAMLGSSR GHIFMGEAGV GLGETSHGFS TVGGFHGVSP LGFSAEGNHG AFVEACQRLA  240
LPFEAQEETN AAEVKPENRI LSLEWQDQCC ADAGRESGGY ADNLGLWAGM INVHGPSTTI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010940065.10.0dof zinc finger protein DOF5.6
TrEMBLA0A2H3YAK20.0A0A2H3YAK2_PHODC; dof zinc finger protein DOF5.6-like
STRINGXP_008795919.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-41Dof family protein