PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010939996.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 369aa    MW: 38508.3 Da    PI: 5.7643
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010939996.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.97.8e-073023412463
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  24 KkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     K+ae eeL++ +++L++eN  Lk+ele+++ e+ k++se+
  XP_010939996.1 302 KQAEYEELTNHAETLKEENNLLKEELERMQVECRKMTSEN 341
                     9*************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF077771.6E-30198IPR012900G-box binding protein, multifunctional mosaic region
PfamPF165969.5E-36138266No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGSGEVTTPT ETQKSTSTQE KPPSSPAVVY PDWASFQAYY NATGTPMPPP GFLHSPVALS  60
PQGHPYLWGP QMLPSYGTPP PYVAMYPHGG LYPHPSIPPG SYPYSPFATP SSNGTAEASV  120
AGASGAETDG KLHAGKQRSP LKKSRGSLGS LNMLTGKVND TRHASGASAN GAFSQSGESG  180
SEVSSEGSDA DSQNGSQQRH GSEHGSGNEG ANKASGARTT SNEVTQTLPT PAVLNATVPF  240
VAIPPGGLAG PATTLNIGMD YWGGPAPISA VRGKLSAASS TALLVPSSHE GSRDRVPPDC  300
SKQAEYEELT NHAETLKEEN NLLKEELERM QVECRKMTSE NATLTEKLKI HWGKESREDE  360
QVDPVNGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939996.10.0PREDICTED: transcription factor HBP-1a-like isoform X2
TrEMBLU5CZF72e-97U5CZF7_AMBTC; Uncharacterized protein
STRINGSb01g041480.17e-88(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35530.14e-51basic region/leucine zipper transcription factor 16