PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010939816.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family M-type_MADS
Protein Properties Length: 359aa    MW: 40542.9 Da    PI: 6.44
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010939816.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.44e-23953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr en+s rqvt+skRr+gilKKA+ELS+LCd+++ +++fs+tgk
  XP_010939816.1  9 KRLENTSGRQVTYSKRRAGILKKAKELSILCDIDIILLMFSPTGK 53
                    789****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.189153IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-31160IPR002100Transcription factor, MADS-box
CDDcd001204.68E-26254No hitNo description
SuperFamilySSF554551.57E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-18323IPR002100Transcription factor, MADS-box
PfamPF003199.7E-201154IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGRVKLKIKR LENTSGRQVT YSKRRAGILK KAKELSILCD IDIILLMFSP TGKPTICLGE  60
RSNIEDVVAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSS AQTVEILTLL  120
LAQEFMNHSR LLQAQISEVQ KRLSYWSEPE KINSIDHIRA MEESLKHSLN QVQLHKENLG  180
KQLMSLECAS QFQNGIHLPL EIGGEQQSSN ISWLHDNEGQ PMMLPEESNL PPQRECSTEV  240
SLQGFPGYFS TGKETEADGQ INDDTLDQLG QNACLGLQLA GHYPYRSYGL NLLHEKEFKP  300
QAEVNLQEAT VEYQMNSFEP PRPRYDASIQ TWASTSGSCG VTVFSNHSYR QQPTGLHDS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939816.10.0agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ1PFA45e-92AGL30_ARATH; Agamous-like MADS-box protein AGL30
SwissprotQ7X9I06e-92AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A2H3YRH80.0A0A2H3YRH8_PHODC; agamous-like MADS-box protein AGL65 isoform X1
STRINGXP_008802579.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.13e-83AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]