PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010939813.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 483aa    MW: 52527.9 Da    PI: 6.2003
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010939813.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.6e-39129189262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s +tkfCyynny+++qPr+fC++C+ryWt+GG++rnvPvG+grrknk+s 
  XP_010939813.1 129 PDKILPCPRCNSLDTKFCYYNNYNVNQPRHFCRNCQRYWTAGGTMRNVPVGAGRRKNKNSM 189
                     7899******************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29127186IPR003851Zinc finger, Dof-type
PfamPF027018.9E-32131187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.826133187IPR003851Zinc finger, Dof-type
PROSITE patternPS013610135171IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MKAEESGRQR EQQNRETGEM ADSRDPAIKL FGKTIPLPAG GEAPAVSGDD EREKDEAKGS  60
SDEEATHEST DMDHDSPNSE DKSGSPISST ANETPKNSAD QETIPVKNLK PEEQKNEVNT  120
SQERTKKKPD KILPCPRCNS LDTKFCYYNN YNVNQPRHFC RNCQRYWTAG GTMRNVPVGA  180
GRRKNKNSMS QFRRITLSDA AFQTAGPEVP EPIHHTPQKP NGTVLSFGSD TPLCESMASV  240
LNLAEKTGNN CNRNGFHRPE EQMIPFPAVE NCDEHSTGSS VTASNSTDDG SGANMQEPVI  300
QDCQGFPSRI PYINGSPWPY LWSPVPAFCP SSFPVSFHPA PAYWGCPVAG TWSIPWLLPL  360
ASSDNGSSGS GPNSPTLGKH SREGELLSHT NSEKGGSPKQ SKQEGCLWIP KTLRIDDPEE  420
AAKSSIWATL GFKHDTANGV SGGGLFKAFQ KKVEVKNHTA ETSPALHANP AALSRSLNFQ  480
ESS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939813.10.0cyclic dof factor 3
TrEMBLA0A2H3YR470.0A0A2H3YR47_PHODC; cyclic dof factor 3-like
STRINGXP_008802580.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.14e-93cycling DOF factor 3