PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010939413.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 387aa    MW: 40291.3 Da    PI: 9.5971
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010939413.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.61.7e-15332383556
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                     +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+a+N++L+k+ ee+ ++ 
  XP_010939413.1 332 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKAQNQDLQKKQEEMMEMQ 383
                     79******************************************99999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-11328387IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.105330381IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-10332381No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-14332381No hitNo description
PfamPF001702.0E-13332384IPR004827Basic-leucine zipper domain
CDDcd147073.43E-26332386No hitNo description
PROSITE patternPS000360335350IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MMNLKNMGSS DGKDGRPPAQ LPLARQPSVY SLTFDEFQST LGGVGKDFGS MNMDELLKNI  60
WTAEESQAMA TALGGAGGAV GGGGLDGSGA GIGLQRQGSL TLPRTLSQKT VDEVWKDLIR  120
ESGLGSSSGT ELHQQRQPTL GEMTLEEFLV RAGVVREDMA MAAAPRPIGN SSNTNNNTNS  180
NVFYGELPNS NNNTGLALGF SQTGRGNGCV VTNTITNSSG ANLGIPATGT RPYAAPLPLG  240
NTADLGNPQG MRGVGIVGLG DQGVNNGLMP GVVGLGGGGV TVGVVGSPVN QMSTNGLGKG  300
GDLSSLSPVP YVLSGGLRGR KGGGAVEKVV ERRQRRMIKN RESAARSRAR KQAYTMELEA  360
EVAKLKAQNQ DLQKKQEEMM EMQKNQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010939413.10.0PREDICTED: bZIP transcription factor TRAB1 isoform X2
SwissprotQ9M7Q41e-100AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLG8FGG51e-157G8FGG5_ELAGV; Putative abscissic acid
STRINGGSMUA_Achr6P30550_0011e-153(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.21e-44ABRE binding factor 4