PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938842.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 701aa    MW: 75421.4 Da    PI: 7.0197
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938842.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.77.1e-15187248162
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     e+e+kr  r+++NRe+A+ sRqRKk ++eeLeekvk + +   +Lk +++ +  e a+l+++
  XP_010938842.1 187 EEEDKRKARLMRNRESAQLSRQRKKHYVEELEEKVKLMHSTINELKTKISYIMAENASLRQQ 248
                     799********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-16187251IPR004827Basic-leucine zipper domain
PfamPF001701.2E-12187249IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806189249IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-13191249No hitNo description
Gene3DG3DSA:1.20.5.1707.6E-17191249No hitNo description
CDDcd147042.12E-20192243No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MAEHSFLDPS PFGSNPSMDT SYPPFFDSDL TLDDLPLPDD FAADFAFHDL DISTDFPIED  60
LLRSPEDQPF PPSGDGSPLP DSNDGSGVSS SCPASGHQTS DLSRNNGPSS PDSGHSATCS  120
PDSANFSGIS SQEEVKLEEE NSRWSLKRKQ DREDGCPNLS PTPNPRNSKY QRSEEGNCAS  180
AFNAGSEEED KRKARLMRNR ESAQLSRQRK KHYVEELEEK VKLMHSTINE LKTKISYIMA  240
ENASLRQQLG GSSGNCPPPG VYPPPPMAPV HFPWIPGYAL RPPGSQVPLV PIPKLKPQQP  300
TSTPRAKKSE SKKSESKVKK VASVSLLGLL FALLFFRSVI PGVTPRNGGD RDEIVGGLGV  360
AKGAIFGQSK SRILSVSGRG SGLNSTDEIG LCNGKMGFGE GGVDRVTGRR CETGVDGSVF  420
KVKQNSSETL PALLYVPRNG KHVKINGNLI INSVLASEKA MARTNSRDQV RQSSGKEGKE  480
TGLAIPDNVA LALALSKSGR EVDQHSNTYR SSGEHQRALA SDTEDVYRDN SKSIPADGPL  540
HQWFREGMTG PVLSSGMCTE VFQFDVSPAS TSGGIIPATK IVNASVANAT GKLPSSAHQR  600
KMKNRRIMYP EPIPLPGTTL NDTEYFAEPS ESSKLHDNKS VSSMVVSVLA DPREAGDGEG  660
DARISPKSLS RIFVVVLLDG VKYVTYSCGL PFKGSGPHLV N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1598605QRKMKNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938842.10.0PREDICTED: uncharacterized protein LOC105057834
TrEMBLM0RV990.0M0RV99_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P25190_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-122bZIP family protein