PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938302.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family CAMTA
Protein Properties Length: 897aa    MW: 100520 Da    PI: 6.6931
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938302.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-11261.5e-3938436117
            CG-1  36 sgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117
                      g+++L++r ++r+frkDG++wkkkkdgktv+E+hekLK+g+ e +++yYa+s+++p+f rrcywlL+++le+ivlvhy+++
  XP_010938302.1   3 GGTILLFDRTMLRNFRKDGHNWKKKKDGKTVQEAHEKLKIGNEERIHVYYARSDDDPNFYRRCYWLLDKNLERIVLVHYRQT 84 
                     699****************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010761.8E-33185IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143757.031190IPR005559CG-1 DNA-binding domain
PfamPF038596.8E-34383IPR005559CG-1 DNA-binding domain
SuperFamilySSF812963.01E-12341427IPR014756Immunoglobulin E-set
CDDcd002049.93E-14512642No hitNo description
PfamPF127962.1E-6530611IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.4E-14532648IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.64E-14533648IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029714.239550615IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.568583615IPR002110Ankyrin repeat
SMARTSM002481.6E-5583612IPR002110Ankyrin repeat
SMARTSM002484100622651IPR002110Ankyrin repeat
SuperFamilySSF525401.49E-7698802IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS500967.144733762IPR000048IQ motif, EF-hand binding site
SMARTSM000153751773IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.675752781IPR000048IQ motif, EF-hand binding site
PfamPF006120.0014754772IPR000048IQ motif, EF-hand binding site
SMARTSM000151.6E-4774796IPR000048IQ motif, EF-hand binding site
PROSITE profilePS5009610.182775799IPR000048IQ motif, EF-hand binding site
PfamPF006123.0E-5776796IPR000048IQ motif, EF-hand binding site
SMARTSM000151.1855877IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.157857885IPR000048IQ motif, EF-hand binding site
PfamPF006120.092858877IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 897 aa     Download sequence    Send to blast
MNGGTILLFD RTMLRNFRKD GHNWKKKKDG KTVQEAHEKL KIGNEERIHV YYARSDDDPN  60
FYRRCYWLLD KNLERIVLVH YRQTSENPPT LVECTDASSL TNRMHHGSPS TPMISSGSAR  120
SELSGSAVMS EEINSREDRA INTGSGISLS DKYNELRNQE FSLHDINTLD WEDLVEPPTS  180
TVSVLCREGD ALSSVQQMPD GLRNSVNNLS VLPSHDVVEG VPSSGHPTDI TNDNGIDGVN  240
CSGYFQAAKD QENPSLLFET MNSTIQEADF KLDSAHSSAS PDIFTGDVFL THNSFGGWNS  300
MNEDSFGLVT EQLEALNSSG DKSNAFTIMD QSSTTEQIFS ISDISPGWAY STEETKVLVV  360
GHFTDPYKHP MTSNIYCAFG EMHAAAELIQ AGVYRCTAMP HPPGSVNFFM TLDGYTPISQ  420
VLSFDYRSVP SDKLDGGVTS SEDDNNNLKG KEFQVQTRLA HLLFSTTNNI SIQSSRTQSK  480
SLKEAKRYAS VTSPLMEKDW MNLLRLSSNG EAFHVPATKD LFELVLKNKL QEWLLEKVAE  540
GCKTPAHDSQ GQGVIHLCAI LDYAWAAHLF SLSGMSLDFR DASGWTALHW AAYFGREKMV  600
AALLSAGANP SLVTDPTPEF PGGCIAADLA SNQGFEGLAA YLAEKGLTAH FQAMSLSGNI  660
SAPLLPSSTD KSSSENLYPE NLTEQELCLR ESLAAYRNAA DAADRIQAAF RERALKQQTK  720
AVQLVKPEIE AAQIVAALKI QHAFRNYSRR RIMKAAARIQ SNFRTWKTRR HFLNMRKHAI  780
KIQAAFRGHQ VRKQYHKIIW SVGVLEKAIL RWRLKRKGLR GVQVESKEAM KVDSNEESTG  840
EEEFFRISRE QAEERVKRSV IRVQAMFRSH RAQQEYRRMK LAYEQANLEF NELDQRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938302.10.0PREDICTED: calmodulin-binding transcription activator 5-like isoform X2
SwissprotO234630.0CMTA5_ARATH; Calmodulin-binding transcription activator 5
TrEMBLM0TPA20.0M0TPA2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P10490_0010.0(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators