PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938282.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family CPP
Protein Properties Length: 814aa    MW: 88839.5 Da    PI: 6.5325
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938282.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.91.5e-16494532240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+CnCkkskClk+YCeCfaag++Cse C+C++C+Nk 
  XP_010938282.1 494 ACKRCNCKKSKCLKLYCECFAAGVYCSEPCSCQGCFNKP 532
                     589**********************************96 PP

2TCR50.93.1e-16579617139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  XP_010938282.1 579 RHKRGCNCKKSNCLKKYCECYQGGVGCSISCRCEGCKNA 617
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-18493534IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.756494619IPR005172CRC domain
PfamPF036385.1E-12496531IPR005172CRC domain
SMARTSM011145.6E-17579620IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11581617IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MDTPERSKIG GTPLSKFEDS PVFSFINSLS PIQPVKSIDP VHSVQSYLPS IPSIFTSPHA  60
NLRESRFLIR NSFSDFSKHE SSSDNVDESN LSTGVLNAVR LSRCTVIAQE NCSIICSLNE  120
ATVDPPDECA TLPGNLPQPE QYDPGSPNHN IAPCFGIKMD FKLDIGHAPL ELVHFVQNGL  180
ERRKNLFVSE TEFLENHPPE QNRDEMVGCE WENLISDDAD SLLIFDSNNE SEACKGPSEK  240
LEDSSKLAGD LDCSQKTQTN ESSGRCVQTA SQDPSVSCSK ENGKQDETDH TPQILSDTCQ  300
SQVVLSDLIE KTANGTSDHI RLGHKVDSQQ QRGMRRRCLV FDTAGFSKKN LQNSSNLHSS  360
ASLLSNEKMA SDDKCSRPGT SHSPCVLPGI GLHLNTLATT SKDRLITQEM LVSGKQLISM  420
PCSVGPFAPT TSGQKSKSLS VEKDMSSNGN EVQNLQIMHD DASQVPALGN GEELNQGSPK  480
KKRRKSENGG ESDACKRCNC KKSKCLKLYC ECFAAGVYCS EPCSCQGCFN KPIHEEMVLA  540
TRKQIESRNP LAFAPKVIRT SETGQETGED ANKTPASARH KRGCNCKKSN CLKKYCECYQ  600
GGVGCSISCR CEGCKNAFGR KEGIVLIGAE EIEQGEEETN PCEREKDKPD DDGQQHANVK  660
IDENHSSENV LSVTPLQTRR PPVKLPLFSS AKPPRSSTLS VGFSPWLFTS QPIRKSEIPL  720
PQHKLEKHVS TALEDDTPDI LRCGASPSNG VKTASPNRKR VSPPHNGIGL SPSRKGGKKL  780
ILKSIPSFPS LTGDVCEDYP MNYSNSSFCS STCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1749661612120Protein lin-54 homolog
5fd3_B7e-1749661612120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1479483KKKRR
2479484KKKRRK
3480484KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938282.10.0protein tesmin/TSO1-like CXC 3 isoform X1
TrEMBLA0A2H3XX470.0A0A2H3XX47_PHODC; protein tesmin/TSO1-like CXC 2
STRINGXP_008789994.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-122Tesmin/TSO1-like CXC domain-containing protein