PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938141.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 518aa    MW: 56120.6 Da    PI: 4.995
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938141.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.76.8e-40130190262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  XP_010938141.1 130 PDKVLPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHSA 190
                     78999*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30116187IPR003851Zinc finger, Dof-type
PfamPF027012.6E-32131188IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.975134188IPR003851Zinc finger, Dof-type
PROSITE patternPS013610136172IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MSEPRDPAIK LFGKTIPLLE RLPPPATAAA AVEAEDKEEC PNDPAPAPEL PEDGEKDTCK  60
EKTDMENNDP MLDAPEELNQ DDPNSSGLNI GSEDENKAHN QDTEVSTDSK AEHDKTEADS  120
SGQEKVLKKP DKVLPCPRCN SMDTKFCYYN NYNVNQPRHF CKNCQRYWTA GGTMRNVPVG  180
AGRRKNKHSA SHYRHIMMSS DGLASGRIDA SDLIPHQALP CGPSVPMRSV KGNGTVLKFG  240
PEVPLCESMA SVLNLGEQKK NSDLGSIACG ENREEPSCAP SVTASNCVEN GFPENAPHME  300
QNGMQGYCNG LTPMPHLQCY PGAPWAYPWG PGWNNIAAMA AGRCSSELVY GPENGSPSLI  360
PWSPPPMMTA LAFCAPTIPF PFMPPSFWGC MSSWPNGAWN APWIGSNGSI SPSSSTRSNG  420
CLGNSSPTLG KHSRDASLQG EEKMEKSLWV PKTLRIDDPD EAAKSSIWAT LGIKPEEGGI  480
FKPFQSKAES KRQTSDDTQV LHANPAALSR SQSFQENT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938141.10.0cyclic dof factor 3
TrEMBLA0A2H3Y4L30.0A0A2H3Y4L3_PHODC; cyclic dof factor 3-like
STRINGXP_008793337.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-71cycling DOF factor 2