PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010938010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 386aa    MW: 41481.2 Da    PI: 6.7467
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010938010.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.6e-10192239552
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                     kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  XP_010938010.1 192 KRAKRILANRHSAARSKERKARYISELERKVQALQTEATTLSAQLTLF 239
                     9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.6E-14188252IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.507190253IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.9E-10192246No hitNo description
PfamPF001707.1E-9192238IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.89E-10192243No hitNo description
CDDcd147031.29E-21193242No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MLPKSQDPSH LPNPNPSTNL NLSSTFPPNA PAVAAGAVAM FQSAGPAASP RGVHHRRARS  60
ELAFRVPDDL DLSSGDPLEG GSFDIGLEDD LFCAFMDIEK IGCRLEGSGS GSEGGVCRDR  120
AAESSEGGED RKIGNAAGAV AVRPKHRHSN SIDGSSMSSG TTRGEGVFGE VVEAKKAMTA  180
EELAELAAID PKRAKRILAN RHSAARSKER KARYISELER KVQALQTEAT TLSAQLTLFQ  240
RDTTGLSAEN AELKLRLQAM EQQAQLRDAL NEALKQEVQR LKIATGEISN PGETYDTGLQ  300
HVRYSAPFYV LSQQQPVHHQ GIQLQPQSHQ SQPSVSNHQF ARPTALPDRM QQDPLGRLQG  360
LDISKGSLIV KSESSSISAT ESSSTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010938010.10.0PREDICTED: transcription factor RF2b-like isoform X1
SwissprotQ6S4P41e-129RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0KDF41e-135A0A0E0KDF4_ORYPU; Uncharacterized protein
STRINGGSMUA_Achr6P32530_0011e-130(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.12e-67bZIP family protein