PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010937644.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 347aa    MW: 36134.5 Da    PI: 9.4446
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010937644.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-3971131262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+++
  XP_010937644.1  71 PEPALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRTK 131
                     67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3555124IPR003851Zinc finger, Dof-type
PfamPF027011.1E-3274129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.73975129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MVFPSVPVYL DPPNWNQQAF HQPGSSRGGV SGEAPQLPTG AVAPRPEGPM AGSIRPGSMA  60
ERARLAKIPQ PEPALKCPRC DSTNTKFCYF NNYSLSQPRH FCKTCRRYWT RGGALRNVPV  120
GGGCRRNKRT KSANSSSSKS SAATTTADRQ ACASSSTSST ATSVGMGGAI PSNLPMPSQL  180
PFMPPSLHPL ADYNHPNIGL SFAGIQPVDA VDYQVGINSS SGGGVGLEQW RLPQIQQFPF  240
LGALEPTLPP PAPVPGLFLF DGEGGGVGAG PFAGSVHMKA TASGLITQLA SVKMEDNQQG  300
LGLPRQYSSV PRNDQYWGSS SGGGSSGGSG WAPDLSGFNS SSAGNLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937644.10.0dof zinc finger protein DOF5.1 isoform X2
SwissprotQ9M2U15e-60DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLA0A2H3X7N21e-159A0A2H3X7N2_PHODC; dof zinc finger protein DOF5.1-like isoform X2
STRINGXP_008779546.11e-159(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-49OBF-binding protein 3