PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010937173.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 457aa    MW: 50113.6 Da    PI: 8.0619
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010937173.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-38102162262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC s +tkfCyynny+++qPr+fCk C+ryWt+GG++rnvPvG+grrknk+s 
  XP_010937173.1 102 PDKILPCPRCSSLDTKFCYYNNYNVNQPRHFCKHCQRYWTAGGTMRNVPVGAGRRKNKNSA 162
                     68999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3095159IPR003851Zinc finger, Dof-type
PfamPF027011.2E-31104160IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.491106160IPR003851Zinc finger, Dof-type
PROSITE patternPS013610108144IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MAESRDQAIK LFGKTIAFPA SDDNRKKEED KGSSDKATIH ETKDKGHDSL DLETKSEPPI  60
SSSANETLRT SADQAATAMK NLKPEEQKNE TGTSQEKMMK RPDKILPCPR CSSLDTKFCY  120
YNNYNVNQPR HFCKHCQRYW TAGGTMRNVP VGAGRRKNKN SASQFRHISV SDATFQTVRP  180
EVPDPIHHPP LKPNGTVLSF GLDTPRCESV ASVFNLANKT MKNCNQNGFH RPEEQVAPFS  240
AVENGDDRSS GSSVTASNST GDGIGANQQE PVIQNCQGVP DQSPYISGSS PWPYPWSPVP  300
AFFSSNYPLS FYPAPAYWSC AGPGTWSFPW ICPPTSSSNG SSGAGSNSPT LGKHSREGEV  360
LDNTDSEKGE SLKPSNQERC PWIPKTLRMH DPKEAAKSSI WTTMGFKYDS ADVISGGMLF  420
KAFQKKEGTK NHTAETSQIL HANPAALSRA LYFQESS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937173.10.0cyclic dof factor 3 isoform X2
TrEMBLA0A2H3YR470.0A0A2H3YR47_PHODC; cyclic dof factor 3-like
STRINGXP_008802580.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.17e-53cycling DOF factor 3