PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936937.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRF
Protein Properties Length: 304aa    MW: 33887.7 Da    PI: 6.8921
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936937.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.91.8e-2382125144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg+  srk++e
  XP_010936937.1  82 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKRSSRKHVE 125
                     79****************************************97 PP

2QLQ591.4e-201550237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT +Q+q+L++Q+l++KyLaa+ P+P +L+++i++
  XP_010936937.1 15 PFTESQWQELEHQALIFKYLAAGIPIPNDLILPIRR 50
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.7E-111450IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.7E-151549IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.9491550IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.02882126IPR014977WRC domain
PfamPF088799.2E-1983125IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MMMMIGGNGS RSRYPFTESQ WQELEHQALI FKYLAAGIPI PNDLILPIRR SLLLDSPTLG  60
FPHPPSIGWG CFQMGYGRKV EDPEPGRCRR TDGKKWRCSK EAYPDSKYCE RHMHRGKRSS  120
RKHVELSLAS NPTSAQLSSP YSPLLSLSPP EAHHALFPCS SSSGSPGIGF STHNNIPYSH  180
LDTACLSADN SNREFYGLKK DVNEYNFFSE ASGAEREGKF RPLGLTSMDE SQQSSNFAVA  240
FASGEVKAVE LEDSQNPKPF HCFFDEWPQR GTGSCISLEE DRSQQASYSN TQLSISSSLY  300
HNDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936937.10.0growth-regulating factor 1
TrEMBLA0A3Q0HQP21e-131A0A3Q0HQP2_PHODC; growth-regulating factor 1-like
STRINGXP_008777426.11e-133(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-51growth-regulating factor 5