PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936861.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family G2-like
Protein Properties Length: 408aa    MW: 44926.1 Da    PI: 7.1474
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936861.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32233286255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010936861.1 233 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 286
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15230287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28231287IPR009057Homeodomain-like
TIGRFAMsTIGR015579.9E-24233286IPR006447Myb domain, plants
PfamPF002497.2E-7234285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MPIQGVFMET SSMPSPDLSL HIRPPRTSPS STPDTDHDLG LDLLQRIEAL KPQADTCSNF  60
ACTDLTLSSP LATSAADSPW RWQGPWQDRC HNGHLSELVL DGPRPIKGIP IYNGSTSPFL  120
SADPKMSSIP SLWSSFGSSV PSSPSCSSGY SSNLDTTTSF LHPLGLLPSM GSSHHPMMAP  180
PARFTGLSSD AGKYYNHHYH HHQYGIGPLD VPHNMMRSRL LQKLPAKRSV RAPRMRWTST  240
LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH LQMYRTVKST DKPAASSAQS  300
EGSGEEDSAL GTGDLSFHQP LEHEGSNKPV QQKDMDSSTS WRNSSNRRAW MQTNPRDMEG  360
LEPTTFTSRT EDSHLCRSNG SVGSHEELKN PSLEFTLGRP GWHGREQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16234288357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16234288458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936861.10.0probable transcription factor RL9 isoform X1
TrEMBLA0A2H3YG990.0A0A2H3YG99_PHODC; probable transcription factor RL9 isoform X3
STRINGXP_008798291.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-46G2-like family protein