PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936713.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 292aa    MW: 32192.2 Da    PI: 7.2758
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936713.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.83.1e-4052111261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +++alkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+s
  XP_010936713.1  52 HDQALKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRS 111
                     7899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3050110IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3353110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.35756110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVTPSMQICM DSSDWLKSIV HEESGMVSSS PSGELISCSR PPMMERRLRP QHDQALKCPR  60
CDSTHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGSLRNVP VGGGCRKNKR SVAKKPSEQP  120
PQHVSSFHDA TDLHLSFSGV QFPHLGSLAD TPRNLNFIEC KYNPSVESSA GGLDLMMDTR  180
FGAMLGSSRG HSFSDLGLGE TSHGFALGGF PGVNQLGFSV DGNHEALVEA CQRLALPYEA  240
HENPSAVEVK PDNRILSLEW QDQYCADGGR ESMGYSGLWN GMINCHGPST TI
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:19915089, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936713.10.0dof zinc finger protein DOF5.6 isoform X1
SwissprotQ9FM032e-38DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A2H3XE760.0A0A2H3XE76_PHODC; dof zinc finger protein DOF5.6-like isoform X1
STRINGXP_008782476.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.19e-41Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]