PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 160aa    MW: 17875.3 Da    PI: 7.4541
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936666.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.75e-133082557
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                    ++++r+ +NRe+ArrsR RK++ ++ L   v  L +eN++    l+  ++++ 
  XP_010936666.1 30 RKQKRMLSNRESARRSRMRKQKHLDDLMAQVGHLRKENSQILTALNITTQHYL 82
                    79*************************************99887777666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-172690IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.7722891IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-1028105No hitNo description
PfamPF001702.3E-103074IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.38E-133081No hitNo description
CDDcd147021.43E-203181No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MASSSGTSSA SSQLPNSGSE DDLQALMHQR KQKRMLSNRE SARRSRMRKQ KHLDDLMAQV  60
GHLRKENSQI LTALNITTQH YLGVEAENSV LRTQMMELNT RLQSLDEILC YMNGGGSNDF  120
GFGVVSNGLE ATDDCFMRPW SLMAMNCQPI MASAGMFQYC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936666.11e-117PREDICTED: ocs element-binding factor 1-like
TrEMBLB9R7Z25e-60B9R7Z2_RICCO; Ocs element-binding factor, putative
STRINGPOPTR_0005s25290.18e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44593367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.16e-47basic leucine-zipper 44