PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 174aa    MW: 20202 Da    PI: 10.3204
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936180.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76.1e-1461106550
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     +r rr+++NRe+ArrsR RK+ ++eeL+ +v  L +eN+aL ++l 
  XP_010936180.1  61 RRRRRMISNRESARRSRMRKQRYLEELRAEVNRLRSENRALENRLA 106
                     799**************************************96654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.5E-1351108No hitNo description
SMARTSM003389.3E-1657121IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.49659108IPR004827Basic-leucine zipper domain
PfamPF001703.8E-1160107IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-1161110No hitNo description
PROSITE patternPS0003606479IPR004827Basic-leucine zipper domain
CDDcd147028.88E-1666112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MLALEEALDL PFPLLEQVFN DELGFTPWET QPTPDHETFA RTGPQPGRDE PDRPPSLDEE  60
RRRRRMISNR ESARRSRMRK QRYLEELRAE VNRLRSENRA LENRLATMVH CCLLFRRDND  120
RLQSVSAALN RRISELRRVL LLRRQLHRLS SPASATVCGG FAPGTDQTVS SLIV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17380RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936180.11e-122PREDICTED: ocs element-binding factor 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17765510
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37730.11e-07basic leucine-zipper 7