PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010936048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 456aa    MW: 48826.1 Da    PI: 4.7038
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010936048.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.73.9e-16244300359
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                     + kr+rr+++NRe+ArrsR+RK+a + eLe  v +L  eN++L k l   ++++ + 
  XP_010936048.1 244 DAKRARRMISNRESARRSRRRKQAHLNELEAQVSQLRVENSSLLKSLTDVNQKYNEA 300
                     68******************************************9999999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.6E-12241297No hitNo description
SMARTSM003385.8E-19242306IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.484244299IPR004827Basic-leucine zipper domain
PfamPF001702.1E-13245298IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11246296No hitNo description
CDDcd147023.76E-7247298No hitNo description
PROSITE patternPS000360249264IPR004827Basic-leucine zipper domain
PfamPF124988.8E-41313430IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MERVFSVDEI ADSFWAASPP GHGLPPPVAT DGGPRGAMSR SPSEWYFEKF LEVAEEATVP  60
STTSPAPPNP NPNPNSNPNL NPSPPPASVV ASNFYGGGRK DEGRGDDDEV IQIKAPAIVP  120
ATVALHRGPP SDPPMDVDPE EYAVLLKKRL DMYCAAVAMS RSSGVNPQDS SASTDIKSQF  180
LDASELGSQA PATGSGPSGG PVPTVMQNLG VQARPTTSGS SREQSDDEEL EGEVETTENM  240
DPADAKRARR MISNRESARR SRRRKQAHLN ELEAQVSQLR VENSSLLKSL TDVNQKYNEA  300
AVDNRILKAD VETLRAKVKM AEDTVKRVTG ISPMYPNIPD ISTISMSFSG SPSDATSSVV  360
VPIQDDPNHF FQQPPPHDQR INTCLPEIAP APPVEHVVHG AVPGDKISST TSIQQVAGLE  420
HLQQRICRGQ SPCGSVQWDA AAPDPEASVN SKQNQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1258265RRSRRRKQ
2260265SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936048.10.0PREDICTED: light-inducible protein CPRF2-like isoform X2
TrEMBLM0S7F21e-145M0S7F2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P12610_0011e-145(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.27e-53bZIP family protein