PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRAS
Protein Properties Length: 571aa    MW: 64008.9 Da    PI: 5.7519
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934553.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS425.64e-1301895561373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+lL++cAe +ssg++e+++  L+rl el+sp g+p++R+aayfteALa r+++ +++++++ pp+   +++ ++ ++al+l+++vsPi+kf h
  XP_010934553.1 189 LVSLLTSCAESISSGNHEAITFSLSRLGELSSPMGTPIHRVAAYFTEALALRVVKLWPHIFSITPPRVLVDQTDDDDATALQLLNQVSPIPKFLH 283
                     689******************************************************************************************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +t N+ +l+ +eg++rvHiiDfdi+qGlQWp+L+q+LasRp++p ++RiTg+g+    s++ l+etg rLa+fAe++++pfe+++ v++rled++
  XP_010934553.1 284 FTMNERLLRGFEGKDRVHIIDFDIKQGLQWPSLFQSLASRPNPPSHVRITGIGE----SRQDLQETGARLARFAEAFNLPFEYHA-VVDRLEDVR 373
                     ******************************************************....9**************************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     l++L+vk++E++aVn++l +h+ l ++   +    ++L l++s++P +v ++eqea+hn++++ +r++++l++ysa+fdsl+ +lp +s +rik+
  XP_010934553.1 374 LWMLHVKREECVAVNCILVMHKALYDESGGA--LMNLLGLIRSTNPAIVLLAEQEAQHNDPRWETRLANSLQHYSAIFDSLDYSLPVDSPARIKI 466
                     **********************985544333..468*********************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee...sgslvlgWkdrpLvsvSaW 373
                     E++ ++rei+n+vaceg+er+ rhe++e+W++ +e+ GF++  ++e+++ q +l+lr+++++ y+++ +   +g l+l W ++pL++vSaW
  XP_010934553.1 467 EEM-FAREIRNLVACEGSERIDRHEKFERWKNLMEDGGFRSTGIGEREMLQSRLILRMYNGENYSIDRQgdgDGGLTLKWLNQPLYTVSAW 556
                     ***.********************************************************999****766669****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.05163534IPR005202Transcription factor GRAS
PfamPF035141.4E-127189556IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MSMALCSRFA APPVAQAVSW EGRIEITEGG LWERRRSSKR FHERSSSEED SCLDRAKRTK  60
TSDATQLAGG EDDIWFSQCT KEHPLVDEEE EKVFLVPNAA LFPFYNTSSS TLVGSFETEK  120
NLVRSVQPNY KSQSDSSSSS DTHSSSPKRQ KDPFKNVARN GSQIPNSTGS AGRVGQGENT  180
QTEQQGIELV SLLTSCAESI SSGNHEAITF SLSRLGELSS PMGTPIHRVA AYFTEALALR  240
VVKLWPHIFS ITPPRVLVDQ TDDDDATALQ LLNQVSPIPK FLHFTMNERL LRGFEGKDRV  300
HIIDFDIKQG LQWPSLFQSL ASRPNPPSHV RITGIGESRQ DLQETGARLA RFAEAFNLPF  360
EYHAVVDRLE DVRLWMLHVK REECVAVNCI LVMHKALYDE SGGALMNLLG LIRSTNPAIV  420
LLAEQEAQHN DPRWETRLAN SLQHYSAIFD SLDYSLPVDS PARIKIEEMF AREIRNLVAC  480
EGSERIDRHE KFERWKNLME DGGFRSTGIG EREMLQSRLI LRMYNGENYS IDRQGDGDGG  540
LTLKWLNQPL YTVSAWAPID IAGSSSTHLP S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-7418155811380Protein SCARECROW
5b3h_A1e-7418155810379Protein SCARECROW
5b3h_D1e-7418155810379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934553.10.0protein DWARF AND LOW-TILLERING isoform X2
SwissprotQ9CAN31e-164SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A2H3YLZ40.0A0A2H3YLZ4_PHODC; protein DWARF AND LOW-TILLERING
STRINGXP_008800814.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-159GRAS family protein