PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934103.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 309aa    MW: 33575.4 Da    PI: 10.33
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934103.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1506.4e-16239290455
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                     ++r +r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lkk+ eel+  
  XP_010934103.1 239 DRRYKRMIKNRESAARSRARKQAYTNELELEVAHLLEENAKLKKQHEELRMA 290
                     5799*****************************************9999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-12236300IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.266238288IPR004827Basic-leucine zipper domain
PfamPF001709.7E-14240289IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-14240291No hitNo description
CDDcd147079.38E-26240294No hitNo description
SuperFamilySSF579595.81E-12240289No hitNo description
PROSITE patternPS000360243258IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MWSSENDKHN SSSRNNNNNS GHGSSSRIVS SSSTRSSPSS TSSILPQTPR RTMEEVWKDI  60
SPATLHQEKP LAPLMETTQS HPHHHNHHHH RHLHLHRAHP TASPSFRTMI LQDFLSGPCS  120
TVSPAAAAME HIPLPPSSPP LPPTTLSLNS GLELRCLSGG GGAGGGGGGG SLLGNARSRS  180
CSNSNESRDN GQAHKNGHGG SFMPSYFSDA VIGPPSPAGF FSFCAKKRMM PEGPVIDGDR  240
RYKRMIKNRE SAARSRARKQ AYTNELELEV AHLLEENAKL KKQHEELRMA MADQLPNRNA  300
LQRSSSSPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934103.10.0PREDICTED: protein FD-like
TrEMBLM0SXK19e-63M0SXK1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P11220_0013e-62(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.19e-22bZIP family protein