PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRAS
Protein Properties Length: 623aa    MW: 66204.9 Da    PI: 8.2645
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934000.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.62.7e-1042436232374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++ L + + a+ +++le+a a L+ l+  a+p+gdp qRl+a+++ AL +r+ +  +  + al+  + +e  s+++laa+++++++sP++k + +
  XP_010934000.1 243 RQMLSDTVAAIVDRNLEAAAANLSVLKRAANPHGDPEQRLTAMMVAALYSRIEQ--PPSSGALR-HPFAELCSAKHLAATQMLYDLSPCFKHALF 334
                     577888999999*****************************************9..44443332.33333459********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.....egppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnv 180
                     +aN aIlea+   +r+Hi+Dfd++qG Q+++L++aLa+R      + pp ++iT+v++p+s        +  l+ +g+ Lak+A++ gv ++fn+
  XP_010934000.1 335 AANLAILEATRDYSRIHILDFDLGQGRQYVSLIHALAERHrhhpsARPPFIKITAVADPASPfnffnnGSGGLRMVGDLLAKLAQRSGVGLRFNI 429
                     ***************************************9766656699*********9987899999999***********************9 PP

            GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                      v++r+++l+  +L ++pgEalaVnl++ l r+ desv+ +++rde+L+ vksl P+vvv+veq+++ n+++F++rf+ea+ +y al++slea++
  XP_010934000.1 430 -VCRRVAELNEAALGCEPGEALAVNLAFVLSRVADESVTPANPRDELLRRVKSLGPRVVVLVEQDMNGNTAPFAARFAEACGHYGALLESLEASV 523
                     .8********************************************************************************************* PP

            GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLv 368
                     +res er+ vE+  l+r++ n va ega+r+er+e  +kWr+r+++aGF++vpl+ ++a+ +k+ l+     + g++v+ee g l+++W++r L+
  XP_010934000.1 524 GRESGERALVEAC-LARKAANSVAREGADRVERCEVSGKWRARMGMAGFRSVPLGPSVAEPVKARLAASLrsKPGFTVKEEAGGLCFCWSGRVLT 617
                     ***********87.*********************************************999887765433599********************* PP

            GRAS 369 svSaWr 374
                     ++SaWr
  XP_010934000.1 618 VASAWR 623
                     *****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.672216601IPR005202Transcription factor GRAS
PfamPF035149.3E-102243623IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MASGFQGRDL RGGFGFGAGS AIQMPPFTNR SEPAGGEGGA AAAGGVLKRS LNEMEWQQRL  60
QYQHALFLRS VRQRTHLASP ISPLSMVDLS SSSASFFPPD LSTLTPSSSS SSSALSGSCI  120
SSGLGGHVRR QQQNPNPPDF SFSAAAAPSC VTESENKSTT MRNRLLELER RLLDDEDEDE  180
VSASGCSAVT TSEWSQTMQQ LISPPPPAAS AAQNPLSPSP TTSSSSTASS SASCSPPLAT  240
PSRQMLSDTV AAIVDRNLEA AAANLSVLKR AANPHGDPEQ RLTAMMVAAL YSRIEQPPSS  300
GALRHPFAEL CSAKHLAATQ MLYDLSPCFK HALFAANLAI LEATRDYSRI HILDFDLGQG  360
RQYVSLIHAL AERHRHHPSA RPPFIKITAV ADPASPFNFF NNGSGGLRMV GDLLAKLAQR  420
SGVGLRFNIV CRRVAELNEA ALGCEPGEAL AVNLAFVLSR VADESVTPAN PRDELLRRVK  480
SLGPRVVVLV EQDMNGNTAP FAARFAEACG HYGALLESLE ASVGRESGER ALVEACLARK  540
AANSVAREGA DRVERCEVSG KWRARMGMAG FRSVPLGPSV AEPVKARLAA SLRSKPGFTV  600
KEEAGGLCFC WSGRVLTVAS AWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-442436236375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934000.10.0PREDICTED: scarecrow-like protein 8
TrEMBLM0SSA20.0M0SSA2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P26400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-114SCARECROW-like 8