PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010933933.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 522aa    MW: 56291.9 Da    PI: 8.7768
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010933933.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.1e-10376434563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr +r   NR +A rs +RK ++i+eLe+kv++L++e ++L  +l  l+  +  l+s++
  XP_010933933.1 376 KRVKRILANRQSAARSKERKMKYIAELERKVQTLQTEATTLSAQLTLLQRDSVGLTSQN 434
                     8999******************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.2E-18372436IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.806374437IPR004827Basic-leucine zipper domain
PfamPF001702.4E-9376434IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-11376432No hitNo description
SuperFamilySSF579593.66E-11376427No hitNo description
CDDcd147034.53E-24377426No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 522 aa     Download sequence    Send to blast
MEDAARNDLM RQFYRNPSLS VSKAPQNPSE GPQIGGPYRH FGPAFSPESG RRPGIPPASP  60
FSHFPPSAAR SPPSLATGGP VHHSRSLSQP AFFSLDSLPP LSPPPCRDST PTTSLSDSVS  120
ADVSMEDHDA SSLSPPLPPK AGGASRAAGA GLPPRKAHRR SQSEIPFAFF PSSPPPPAAQ  180
LPPASAPLQL VKLESDWDRG LDGMNAAGVC EKKVEADSGD DLFNAYLNLE SLDTLNSSED  240
KRGDLDSGAS GTKTNGADSS ENEAESSMNH SPSVKKKEGA KRSAAGDPGP IGTTTRHCRS  300
LSMDSFMGKL NFGEESPKMP PSSGFLQAAQ TPRANSKDGA SNVFSLEFGN GEFSPVEMKK  360
IMANDKLSEM ALMDPKRVKR ILANRQSAAR SKERKMKYIA ELERKVQTLQ TEATTLSAQL  420
TLLQRDSVGL TSQNNELKFR LQAMEQQAQL RDALNEALTA EVQRLKLATG ELVDGHASNS  480
LNQQRPINPL MFRRQQQQPA QHPLYQLQQQ QNSAGMNHES KK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933933.10.0PREDICTED: transcription factor RF2a-like
TrEMBLF6I1811e-175F6I181_VITVI; Putative uncharacterized protein
STRINGVIT_03s0038g00860.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-90bZIP family protein