PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010932723.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family GRF
Protein Properties Length: 166aa    MW: 18755.4 Da    PI: 10.2328
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010932723.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.92.3e-2583126144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  XP_010932723.1  83 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 126
                     79***************************************998 PP

2QLQ62.98.1e-221247237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT++Q+q+L++Q+l++Ky+a++ P+P++L+++i++
  XP_010932723.1 12 PFTPSQWQELEHQALIFKYMASGIPIPSDLILPIRR 47
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-111147IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-161246IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.7191247IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.66583127IPR014977WRC domain
PfamPF088793.7E-2184126IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MMMSGRNTSR YPFTPSQWQE LEHQALIFKY MASGIPIPSD LILPIRRSFL LDSTIPSPTL  60
AFPPQPSMSW GWNQMGFGRK AEDPEPGRCR RTDGKKWRCS KEAYPDSKYC ERHMHRGKNR  120
SRKPVEMSLA TSLPSSTSSS TPSTSHTPSL HPPPLSISTP DSHQLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932423.21e-118growth-regulating factor 1
SwissprotQ6AWY85e-72GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLA0A2H3XPD25e-89A0A2H3XPD2_PHODC; growth-regulating factor 1-like
STRINGXP_008786732.12e-90(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-54growth-regulating factor 5