PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010932517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family G2-like
Protein Properties Length: 434aa    MW: 47158.3 Da    PI: 7.7579
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010932517.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-32249302255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_010932517.1 249 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 302
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15246302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28247302IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23249302IPR006447Myb domain, plants
PfamPF002496.4E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MPLEGLLMEA TSMPSPDLSL HISPPSTIPS STSTAATAFE PDRWRPRANS PKSCHDGSDA  60
STELSLSHPS AALEAGPSAA APPQLHDRSH HTHRFVTVGI GSSVDSRPIK GIPIYNNTPF  120
PFLPIDHSKI GFYHPVSSYP PPWSSSSSSL PPTSSFAASS NPDGGATLVH PTSTGGVPPV  180
GSSYHHQMVA APARFNGFSS ESFKAAHHHH HHLHHHHHQY GMGSLDGSHS MVRSRFMSKL  240
PAKRSMRAPR MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY  300
RTVKTTDKPA ASSGQSDGSG EEDLGPGTTD LNFRRFMDQR VSDRPVQPHG MDYSSTTATN  360
TPGTPRWSNS SSRGTWLQTN LSDIDGLRST VFSSQIEDNN PCRSNGLQVS QQEIKNPSLE  420
FTLGRPDWCG TEHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16250304458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932517.10.0probable transcription factor RL9 isoform X1
SwissprotQ0J2358e-64ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2H3XV740.0A0A2H3XV74_PHODC; probable transcription factor RL9 isoform X1
STRINGXP_008789246.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-58G2-like family protein