PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010932454.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 843aa    MW: 94327.4 Da    PI: 8.9404
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010932454.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73.1e-14445487346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT++Ed +l  av+ +G ++W ++a+ +  gRt+ qc +rw+k
   XP_010932454.1 445 DWTEDEDAKLCAAVESFGDNNWQLVASNLE-GRTGAQCSNRWRK 487
                      6*****************************.***********98 PP

2Myb_DNA-binding52.41.2e-16497541247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      grW+ +Ed++l+ av ++G ++W++Ia+  + gRt  qc++rw++ 
   XP_010932454.1 497 GRWSVDEDKRLKVAVMLFGAKNWNKIAQFAP-GRTQVQCRERWLNC 541
                      8******************************.***********996 PP

3Myb_DNA-binding47.63.7e-15550593348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +WT+eEd +l+ a++++G   W+++a +++  Rt+ qc+ rw  +l
   XP_010932454.1 550 AWTEEEDAKLLAAIAEHGYC-WSKVATCVP-PRTDSQCRRRWKVLL 593
                      7*****************99.*********.9**********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.703292382IPR017877Myb-like domain
SMARTSM007170.038296386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-8299315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-8356397IPR009057Homeodomain-like
SuperFamilySSF466893.1E-15366434IPR009057Homeodomain-like
PROSITE profilePS500908.362385437IPR017877Myb-like domain
SMARTSM007170.013389439IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-9398441IPR009057Homeodomain-like
SuperFamilySSF466892.83E-20422492IPR009057Homeodomain-like
PROSITE profilePS5129421.559438493IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-17442491IPR009057Homeodomain-like
SMARTSM007174.1E-13442491IPR001005SANT/Myb domain
PfamPF002491.3E-12445487IPR001005SANT/Myb domain
CDDcd001677.20E-12446489No hitNo description
SuperFamilySSF466891.27E-27493589IPR009057Homeodomain-like
PROSITE profilePS5129413.108494542IPR017930Myb domain
SMARTSM007172.1E-14495544IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-18497545IPR009057Homeodomain-like
PfamPF002491.9E-15497541IPR001005SANT/Myb domain
CDDcd001673.78E-12498540No hitNo description
PROSITE profilePS5129423.521543597IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-18546593IPR009057Homeodomain-like
SMARTSM007172.5E-14547595IPR001005SANT/Myb domain
CDDcd001673.31E-13550593No hitNo description
PfamPF002497.2E-14550593IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MASSSSSTGS DRDEALDEDM EALRRACMLT GAKPVVVDDS DSDSGGESSS TDDIDLLHRL  60
QERFYVPSSD ADSLPFIKPL SSRPPPDSDE EDDFETLRAI QKRFTQYESD VVGRNSQNSI  120
QDTEMVVGDT TSEQETHNTL PKNGKSMVLS EELFASGFTE HAEDGACNVN IGGFMKSQFP  180
KSAKFFVDAL KKNRSCQKFI RRKLIEIEAK IEVNKELKER LQCLMDFQVA CKRKAGRILS  240
QKKDPRVRLI SMRKPTTIKD SKASYKRVSA LCLGPAENSH VSKYKMVLKT FPVSLRKQTW  300
SNMEKEKLPK GIKQQYQEML ILNSMNFESD IDSNLMSALS SSDLYITPEK IRSFIPLVNW  360
DRLASMYLTG RSGAECEARW LNCEDPMINH NPWTILEDKK LLFIVQERGV YNWIDISIAL  420
GSNRTPFQCL ARYQRSLNPH ILNKDWTEDE DAKLCAAVES FGDNNWQLVA SNLEGRTGAQ  480
CSNRWRKSLN PDRRKVGRWS VDEDKRLKVA VMLFGAKNWN KIAQFAPGRT QVQCRERWLN  540
CLDPSLNLKA WTEEEDAKLL AAIAEHGYCW SKVATCVPPR TDSQCRRRWK VLLPHEVPLL  600
QAARKMKRTV LISNFVDRES ERPTIGPNDF TPLVNFSEAE NNDSTTPGKK RSSDNQPKKS  660
RVKSRRSFKE NSTADGVTNS STNAVPTDSA LVCGINSDTA GGGSSKRSRK KKSSDDQPKK  720
LRARSRRSVK ENVAADGKVN SSADKVPSGE SLVHIVSTTT AETGRIKRTR KKTPSDDQLN  780
NSMVKSRGYC KEDIMADGMV NSSTERAPAC LSLVCSSSSS TAENGSIEGT GKRTSSDGAI  840
QEV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-313595973159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-313595973159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1585606RRRWKVLLPHEVPLLQAARKMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932454.10.0PREDICTED: uncharacterized protein LOC105053113
TrEMBLM0TBT60.0M0TBT6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-179myb domain protein 4r1