PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 328aa    MW: 36135.6 Da    PI: 9.4726
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931491.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1491.3e-15258301548
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                     +r++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++Lkk+
  XP_010931491.1 258 RRQKRMIKNRESAARSRARKQAYTNELEYKVSRLEEENERLKKQ 301
                     79***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.3E-13254326IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.507256301IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.25E-11258303No hitNo description
PfamPF001702.3E-13258301IPR004827Basic-leucine zipper domain
CDDcd147076.76E-24258306No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-14258303No hitNo description
PROSITE patternPS000360261276IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MASQGGGGSG GQRFQIESLA RQGFLYSLTL NEVQSHFGEP LTSMNLDELL KSVFPEGNQS  60
LGMDLDAATS QYTSSSGLQR QGSITMPQAL SKKTVDEVWR DIQQGQHKSI EEQRSGRERQ  120
VTLGEMTLED FLVKAGVVVE GSAKDANDMM RSVGPVGSAN PVGGPQDFGQ GAHWLQQYRQ  180
MSAMDQHQQG QQSMMGAYVP SRPVPQPLGL GASPILDAVF PDGQMSISSP GLGALSDPQT  240
PGRKRAASGD KTDKLVERRQ KRMIKNRESA ARSRARKQAY TNELEYKVSR LEEENERLKK  300
QKELDKILFS MPLPEPRYQL RRTSSASF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931491.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES32e-88AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLM0U8H81e-128M0U8H8_MUSAM; Uncharacterized protein
TrEMBLA0A0A9HCS11e-127A0A0A9HCS1_ARUDO; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP12190_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.19e-90ABA-responsive element binding protein 3