PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931109.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 480aa    MW: 53603.1 Da    PI: 7.3531
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931109.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.35.7e-07149211163
                     XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     eke kr rr   NRe+Ar   +R++   eeL++kv+ L+ +Nk +k e e   ke+ +lk+ +
  XP_010931109.1 149 EKEAKRMRRILANRESARQTIRRRQIIREELTKKVADLSLKNKNMKMEKELVMKEYLSLKDTN 211
                     89*********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-6149213IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.301151214IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.91E-5153209No hitNo description
CDDcd147028.59E-11154204No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MEEARRRALG SFGGARRSPS SDRGGSSSTS GSSLPREQWG LDPIVEKELD AAQALAEMAI  60
QQEQENKRIE DHGSPSTSRE ESIREGKGWG LKHEQLVDDY QEDGEAVKDA MEEKKSGQEI  120
SELPKADITC STSRTPFSSR VKQNLAEAEK EAKRMRRILA NRESARQTIR RRQIIREELT  180
KKVADLSLKN KNMKMEKELV MKEYLSLKDT NNQLKEQISK AMNCEFGTSA EATSMQVEIS  240
ASSSTNLPPM IYGKLPMVPY VWPPWLISTI TRPCHEHDGA SVFSGARPHL YLPPCAWFYP  300
SSHEIPGSRS QHPHSPKERH EDPVAIWHDL GQSYGALDYE EKAMMHNSKE TDLSLPHTIV  360
TQEEENGATN NQRLLATVPT EHQMLRHCPY KLGHMSSHCR TLLSSSDVKG GPVTDHDDGT  420
SLEKSGGACS HPNEQLLIAA AAAQARKRRR ELIKLKQLHG RQAGHGGGWN VCFHYLSSAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1445449RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931109.10.0PREDICTED: uncharacterized protein LOC105052102
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-21bZIP family protein