PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931055.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 285aa    MW: 31895.4 Da    PI: 5.2952
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931055.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.89.9e-382983761
          zf-Dof  7 kcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     cprCds+ntkfCyynnysl+qPryfCk+CrryWtkGG++rnvPvGgg+rkn++ 
  XP_010931055.1 29 VCPRCDSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGTIRNVPVGGGCRKNRRG 83
                    7***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-271382IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6772882IPR003851Zinc finger, Dof-type
PfamPF027014.1E-322982IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MLSRVLPYPP QRSLMAYHSW KPNMELAPVC PRCDSSNTKF CYYNNYSLTQ PRYFCKGCRR  60
YWTKGGTIRN VPVGGGCRKN RRGKSARSQA NHPTSLSNLI YDSHGLLDSD RSGHAQHDGM  120
RGSSHHSNKS ELPPSEGSAI DLALLYTKFV NQCPVLNSDP AVPELPGEIM DESFSVMGGA  180
STSVMNQMPD QGLNQLGGWE ITEARFENQM YPEDSNFSLD PGSSESVTFS SEGVVTGNDV  240
TASDCWTPQP MFPGFQPLLE DDMFHHQDLV IGDWYSLDQF YNFDY
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_029122566.10.0dof zinc finger protein DOF4.1 isoform X2
SwissprotQ9SVC51e-36DOF35_ARATH; Dof zinc finger protein DOF3.5
TrEMBLA0A2H3YJW91e-150A0A2H3YJW9_PHODC; dof zinc finger protein DOF3.5-like
STRINGXP_008799722.11e-151(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.15e-39Dof family protein