PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930969.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 300aa    MW: 31960.2 Da    PI: 4.8985
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930969.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.5e-15215266354
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +l+r++r++kNRe+A rsR+RK+a++ eLe  v  Le+eN +L  e ee   
  XP_010930969.1 215 ALQRQKRMIKNRESAARSRERKQAYTVELESIVTHLEEENARLLGEQEEVHR 266
                     79*****************************************988777654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.6E-11213275IPR004827Basic-leucine zipper domain
PfamPF001706.0E-14214266IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749215267IPR004827Basic-leucine zipper domain
CDDcd147073.57E-22217266No hitNo description
SuperFamilySSF579595.06E-11217267No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-14218270No hitNo description
PROSITE patternPS000360220235IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MASSRVMQSS STANSDLACE PSIYSLTMSG DQAKNLGSMN MDDLLRNIYG DGTAAAASPA  60
TPFGGDAGEX AAPPPLAREG SSSLPRSIGS KTVEEVWREI SGGRKVDGGG DGSGYKDATA  120
AEAAAANGEM TLEDFLARAG AVREEDVRVP PGSVAAGGFG VDAVMNDRFS QQQAQLPLEN  180
PMLGFGNGVE AGAGGGGRGG RGRKRQVLDP VDRAALQRQK RMIKNRESAA RSRERKQAYT  240
VELESIVTHL EEENARLLGE QEEVHRQRLK QDFKVWRHDD GDSTSELWLA ISIIMLYGLT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101109GGRKVDGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930969.10.0PREDICTED: LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 4
TrEMBLA5B1F72e-79A5B1F7_VITVI; Putative uncharacterized protein
STRINGVIT_12s0055g00420.t012e-78(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.38e-24bZIP family protein