PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930598.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 367aa    MW: 41356.1 Da    PI: 8.1069
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930598.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.94.3e-082362811762
                     HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     A+rsR RK+++i+eLe+ v++L+ae ++   ele l k+   l  e
  XP_010930598.1 236 AQRSRVRKLQYIAELERNVQALQAEGMEVSAELEFLDKQNLILNLE 281
                     89**********************************9998766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-4225284IPR004827Basic-leucine zipper domain
CDDcd147031.52E-14226275No hitNo description
SuperFamilySSF579592.04E-5236278No hitNo description
Gene3DG3DSA:1.20.5.1706.9E-7236278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MASTKGVANF RNSTSSGKQS FLPPKSPFPT MPVPYADYGT IGTKGIPKLR EGNRHHQRTS  60
SESFLIEEQP SWLDDLLNEP EMPVKRGAHR RSTSDSFAYL DGANIYANME TLVQEEGRQR  120
GISSQPSWGV QDFDRLKDVQ HSPYYTESNS FGKPQNRGWE ALNMVNCTSG GPLAKDKMVH  180
PGSTCVPMEA DAATSYVTEK EQERSPQDSK GTSERKEGSH VKQSDADPKR VKQQFAQRSR  240
VRKLQYIAEL ERNVQALQAE GMEVSAELEF LDKQNLILNL ENKTLKQRLD SLAQEHLIKC  300
LQQEMLEREI ARLRSSYQQQ QQQLQQPPAP AHSRSSSRDL ESQLANLSLK HKEPNSGRDP  360
VTGPLHI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930598.10.0PREDICTED: uncharacterized protein At4g06598-like
TrEMBLA0A067KV231e-140A0A067KV23_JATCU; Uncharacterized protein
STRINGGSMUA_Achr8P29390_0011e-138(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.27e-92bZIP family protein