PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930253.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 413aa    MW: 44756.7 Da    PI: 6.5141
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930253.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.51.9e-10228286563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+     l++e+
  XP_010930253.1 228 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTMLQRDTTGLTAEN 286
                     9*********************************************9998877777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576117No hitNo description
SMARTSM003382.6E-16224288IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875226289IPR004827Basic-leucine zipper domain
PfamPF001709.3E-9228282IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-10228282No hitNo description
SuperFamilySSF579594.42E-11228280No hitNo description
CDDcd147038.58E-24229278No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEKDKSPVHG GVGGSGCGLP PPSSRYTAFA SPSSGFPVKC EASSSSSVTG DASKFGHFSP  60
AVVPETGQFS HDISGMPDYP PRNAGHRRAQ SEILSLPDDI SFDSDLGVVG SGEGPSLSDE  120
TEEDPLSMYL DMDKFTSSSA ISGLDLLGSE TSVTAAAPAP TFPPQTENSA AASNERPRVR  180
HQHSQSMDGS TSIKPEMLAS GSEGPSLAET KKAMSAAKLA DLALVDPKRA KRIWANRQSA  240
ARSKERKMRY IAELERKVQT LQTEATTLSA QLTMLQRDTT GLTAENNELK LRLQTMEQQV  300
HLQDALNDAL KEEVQRLKIA TGQAINGGQM MNFGPSFGAT QQYYHHNQAM QSLLAAQQLQ  360
QLQIHTQHQQ QMHLQQHQPQ VQQQQQQSHT ELKMKGVMTS QRESASDNST SQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930253.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-134POF21_ARATH; Probable transcription factor PosF21
TrEMBLM5XCD01e-173M5XCD0_PRUPE; Uncharacterized protein
STRINGGSMUA_Achr11P14990_0011e-159(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-136bZIP family protein